6KCR: MtlR-HPr complex from Escherichia coli

X-ray structure of the MtlR-HPr complex from Escherichia coli. Determined by X-ray diffraction at 3.5 Å resolution. Released 9 Oct 2019.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Escherichia coli K-12
Chains: 4
Atoms: 3,908
Mol. weight: 63.94 kDa
Released: 9 Oct 2019

Explore 6KCR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KCR contains 22 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	24-37	14
α-helix	42-64	23
α-helix	73-80	8
α-helix	89-99	11
α-helix	104-121	18
α-helix	132-139	8
α-helix	147-152	6
α-helix	158-187	30

Chains B and D: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
α-helix	16-27	12
β-strand	32-37	6	1
β-strand	40-43	4	1
α-helix	47-50	4
β-strand	60-66	7	1
α-helix	70-83	14

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	27-37	11
α-helix	42-64	23
α-helix	70-76	7
α-helix	89-99	11
α-helix	104-121	18
α-helix	132-139	8
α-helix	147-152	6
α-helix	158-187	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mannitol operon repressor	A, C	protein	201	Escherichia coli K-12	P0AF10 (AlphaFold model)
Phosphocarrier protein HPr	B, D	protein	85	Escherichia coli K-12	P0AA04 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6KCR_1 Mannitol operon repressor (chains A, C)
HHHHHHMVDQAQDTLRPNNRLSDMQATMEQTQAFENRVLERLNAGKTVRSFLITAVELLT
EAVNLLVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVINRQEYEDAELLM
ALREELNHDGNEYAFTDDEILGPFGELHCVAALPPPPQFEPADSSLYAMQIQRYQQAVRS
TMVLSLTELISKISLKKAFQK

Sequence of entity 2 (B, D), FASTA

>6KCR_2 Phosphocarrier protein HPr (chains B, D)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Primary citation

Structural insight into glucose repression of the mannitol operon. Choe, M., Min, H., Park, Y.H. et al. Sci Rep (2019) 9:13930-13930. DOI 10.1038/s41598-019-50249-2 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6KCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.