Crystal structure of human DNMT3B-DNMT3L in complex with DNA containing CpGpT site. Determined by X-ray diffraction at 2.86 Å resolution. Released 19 Feb 2020.
Explore 6KDB in 3D Show helices and sheets RCSB PDB PDBe
6KDB contains 58 α-helices and 48 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 575-580 | 6 | 1 |
| α-helix | 586-593 | 8 | |
| β-strand | 596 | 1 | 2 |
| β-strand | 598-604 | 7 | 1 |
| α-helix | 608-617 | 10 | |
| β-strand | 622-624 | 3 | 1 |
| α-helix | 628-630 | 3 | |
| α-helix | 633-639 | 7 | |
| β-strand | 644-647 | 4 | 1 |
| α-helix | 671-682 | 12 | |
| α-helix | 684-685 | 2 | |
| β-strand | 693-699 | 7 | 1 |
| α-helix | 704-713 | 10 | |
| α-helix | 718 | 1 | |
| β-strand | 719-722 | 4 | 1 |
| α-helix | 723-725 | 3 | |
| β-strand | 729 | 1 | 3 |
| β-strand | 732-737 | 6 | 1 |
| α-helix | 745-746 | 2 | |
| α-helix | 756-759 | 4 | |
| β-strand | 765-766 | 2 | 4 |
| β-strand | 771 | 1 | 3 |
| α-helix | 772-774 | 3 | |
| α-helix | 778-780 | 3 | |
| β-strand | 783 | 1 | 5 |
| β-strand | 788 | 1 | 5 |
| β-strand | 791-793 | 3 | 4 |
| β-strand | 796-798 | 3 | 4 |
| α-helix | 802-809 | 8 | |
| α-helix | 811-812 | 2 | |
| α-helix | 823-831 | 9 | |
| α-helix | 836-843 | 8 | |
| α-helix | 844-848 | 5 | |
| β-strand | 852 | 1 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 180-183 | 4 | |
| α-helix | 184-186 | 3 | |
| β-strand | 188 | 1 | 6 |
| β-strand | 192-195 | 4 | 7 |
| α-helix | 200-204 | 5 | |
| β-strand | 218-221 | 4 | 7 |
| α-helix | 229-234 | 6 | |
| β-strand | 240-244 | 5 | 7 |
| α-helix | 245-247 | 3 | |
| α-helix | 256-270 | 15 | |
| α-helix | 272-273 | 2 | |
| β-strand | 281-286 | 6 | 7 |
| α-helix | 292-301 | 10 | |
| β-strand | 307-309 | 3 | 7 |
| β-strand | 321-325 | 5 | 7 |
| α-helix | 340-349 | 10 | |
| α-helix | 361-364 | 4 | |
| α-helix | 365-373 | 9 | |
| β-strand | 375 | 1 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 180-183 | 4 | |
| α-helix | 184-186 | 3 | |
| β-strand | 188 | 1 | 8 |
| β-strand | 192-195 | 4 | 9 |
| α-helix | 200-205 | 6 | |
| β-strand | 218-221 | 4 | 9 |
| α-helix | 229-235 | 7 | |
| β-strand | 240-244 | 5 | 9 |
| α-helix | 245-247 | 3 | |
| α-helix | 256-270 | 15 | |
| α-helix | 272-273 | 2 | |
| β-strand | 281-286 | 6 | 9 |
| α-helix | 292-301 | 10 | |
| β-strand | 307-311 | 5 | 9 |
| β-strand | 319-325 | 7 | 9 |
| α-helix | 340-349 | 10 | |
| α-helix | 361-364 | 4 | |
| α-helix | 365-373 | 9 | |
| β-strand | 375 | 1 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 575-580 | 6 | 10 |
| α-helix | 586-594 | 9 | |
| β-strand | 596 | 1 | 11 |
| β-strand | 598-604 | 7 | 10 |
| α-helix | 608-617 | 10 | |
| β-strand | 622-624 | 3 | 10 |
| α-helix | 628-630 | 3 | |
| α-helix | 633-639 | 7 | |
| β-strand | 644-648 | 5 | 10 |
| α-helix | 671-682 | 12 | |
| α-helix | 684-685 | 2 | |
| β-strand | 693-699 | 7 | 10 |
| α-helix | 704-713 | 10 | |
| α-helix | 718 | 1 | |
| β-strand | 719-722 | 4 | 10 |
| α-helix | 723-725 | 3 | |
| β-strand | 729 | 1 | 12 |
| β-strand | 732-737 | 6 | 10 |
| α-helix | 745-746 | 2 | |
| α-helix | 756-759 | 4 | |
| β-strand | 765-766 | 2 | 13 |
| β-strand | 771 | 1 | 12 |
| α-helix | 772-774 | 3 | |
| α-helix | 778-780 | 3 | |
| β-strand | 783 | 1 | 14 |
| β-strand | 788 | 1 | 14 |
| β-strand | 791-793 | 3 | 13 |
| β-strand | 796-798 | 3 | 13 |
| α-helix | 802-809 | 8 | |
| α-helix | 811-812 | 2 | |
| α-helix | 823-831 | 9 | |
| α-helix | 836-843 | 8 | |
| α-helix | 844-848 | 5 | |
| β-strand | 852 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (cytosine-5)-methyltransferase 3B | A, D | protein | 286 | Homo sapiens | Q9UBC3 (AlphaFold model) |
| DNA (cytosine-5)-methyltransferase 3-like | B, C | protein | 204 | Homo sapiens | Q9UJW3 (AlphaFold model) |
| DNA (25-mer) | E, F | DNA | 25 | synthetic construct |
>6KDB_1 DNA (cytosine-5)-methyltransferase 3B (chains A, D) GHMRRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAVGTVKHEGNIKYVND VRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEG DDRPFFWMFENVVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVI ASKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELER IFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
>6KDB_2 DNA (cytosine-5)-methyltransferase 3-like (chains B, C) GHMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKHVVDVTDTVRKDVEEW GPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDL DVASRFLEMEPVTIPDVHGGSLQNAVRVWSNIPAIRSRHWALVSEEELSLLAQNKQSSKL AAKWPTKLVKNCFLPLREYFKYFS
>6KDB_3 DNA (25-MER) (chains E, F) GCATGCGTTCTAATTAGAACGCATG
| ID | Name | Formula | Copies |
|---|---|---|---|
| SAH | S-adenosyl-L-homocysteine | C14 H20 N6 O5 S | 2 |
Structural insights into CpG-specific DNA methylation by human DNA methyltransferase 3B. Lin, C.C., Chen, Y.P., Yang, W.Z. et al. Nucleic Acids Res (2020) 48:3949-3961. DOI 10.1093/nar/gkaa111 · PubMed
Other PDB entries of the same protein (UniProt Q9UBC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6KDB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.