6KL7: Beta-arrestin 1 mutant S13D/T275D

Beta-arrestin 1 mutant S13D/T275D. Determined by X-ray diffraction at 2.79 Å resolution. Released 29 Jan 2020.

Method: X-ray diffraction
Resolution: 2.79 Å
Organism: Rattus norvegicus
Chains: 2
Atoms: 5,497
Mol. weight: 95.84 kDa
Ligands: BA
Released: 29 Jan 2020

Explore 6KL7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KL7 contains 19 α-helices and 59 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	19-22	4	1
β-strand	26-29	4	2
β-strand	34	1	2
β-strand	37-42	6	1
β-strand	52-63	12	3
β-strand	75-87	13	3
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-117	6	1
α-helix	124-126	3
β-strand	127-130	4	3
α-helix	136-138	3
β-strand	140-151	12	3
α-helix	160-162	3
β-strand	163-168	6	3
β-strand	169-172	4	2
α-helix	175-177	3
α-helix	180-184	5
β-strand	185-189	5	4
β-strand	191	1	5
β-strand	197-203	7	4
β-strand	207-209	3	6
β-strand	214-222	9	4
β-strand	228-241	14	7
β-strand	247-258	12	7
β-strand	262	1	7
α-helix	263	1
β-strand	266-274	9	4
α-helix	278-280	3
β-strand	287-289	3	3
β-strand	295	1	8
β-strand	300	1	3
α-helix	301-304	4
β-strand	317-329	13	7
β-strand	342-349	8	7
β-strand	350-352	3	6
α-helix	353-355	3
β-strand	386-390	5	1
α-helix	393-394	2
β-strand	395	1	8

Chain B: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	7-11	5	9
β-strand	19-22	4	9
β-strand	26-29	4	10
β-strand	34	1	10
β-strand	37-38	2	11
β-strand	39-42	4	9
β-strand	54-63	10	12
β-strand	75-85	11	12
α-helix	99-105	7
β-strand	116-117	2	11
α-helix	124-126	3
β-strand	127-130	4	12
β-strand	140-149	10	12
β-strand	164-168	5	12
β-strand	169-172	4	10
α-helix	181-184	4
β-strand	185-189	5	13
β-strand	197-203	7	13
β-strand	207-209	3	14
β-strand	214-222	9	13
β-strand	228-241	14	15
β-strand	245	1	5
β-strand	247-258	12	15
β-strand	262	1	15
β-strand	266-274	9	13
α-helix	278-280	3
β-strand	287-289	3	12
β-strand	295	1	16
β-strand	300	1	12
α-helix	301-305	5
β-strand	317-329	13	15
β-strand	342-349	8	15
β-strand	350-352	3	14
α-helix	353-355	3
β-strand	387-390	4	9
α-helix	393-394	2
β-strand	395	1	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A, B	protein	422	Rattus norvegicus	P29066 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6KL7_1 Beta-arrestin-1 (chains A, B)
GSHMMGDKGTRVFKKADPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVT
LTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFT
FEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIRKVQYAPE
RPGPQPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVR
QYADICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLDPFLANNREKRGLALDGKLKHE
DTNLASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKP
KEEPPHREVPESETPVDTNLIELDTNDDDIVFEDFARQRLKGMKDDKDEEDDGTGSPHLN
NR

Ligands and cofactors

ID	Name	Formula	Copies
BA	Barium ion	Ba	5

Water and common crystallization additives (EDO) are not listed.

Primary citation

Conformational Dynamics and Functional Implications of Phosphorylated beta-Arrestins. Kang, H., Yang, H.S., Ki, A.Y. et al. Structure (2020) 28:314. DOI 10.1016/j.str.2019.12.008 · PubMed

Other PDB entries of the same protein (UniProt P29066 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
8HST 2.66 Å, The structure of rat beta-arrestin1
9KYU 2.72 Å, Structure of beta-arrestin1 in complex with mouse C5aR1pp
8HSV 3.0 Å, The structure of rat beta-arrestin1 in complex with a rat Mdm2 peptide
8I0N 3.26 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9BT8 3.34 Å, Structure of Src in complex with beta-arrestin 1 revealing SH3 binding sites
9CX9 3.34 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
8J8Z 3.4 Å, Structure of beta-arrestin1 in complex with D6Rpp
8GO8 3.41 Å, Structure of beta-arrestin1 in complex with a phosphopeptide corresponding to the human…
9CX3 3.47 Å, Structure of SH3 domain of Src in complex with beta-arrestin 1
9DNM 3.47 Å, Structure of rat beta-arrestin 1 bound to allosteric inhibitor
9DNG 3.52 Å, Structure of rat beta-arrestin 1 by fiducial-assisted cryo-EM

Browse structure collections

About this viewer

MolViewer shows 6KL7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.