6KWK: MHC class I antigen

Crystal structure of pSLA-1*0401 complex with FMDV-derived epitope MTAHITVPY. Determined by X-ray diffraction at 2.5 Å resolution. Released 9 Sept 2020.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Sus scrofa, Foot-and-mouth disease virus
Chains: 3
Atoms: 3,329
Mol. weight: 44.29 kDa
Released: 9 Sept 2020

Explore 6KWK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6KWK contains 10 α-helices and 30 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-13	11	1
β-strand	21-28	8	1
β-strand	31-37	7	1
β-strand	46-47	2	1
α-helix	51-54	4
α-helix	57-84	28
β-strand	93-103	11	1
β-strand	109-118	10	1
β-strand	121-126	6	1
β-strand	133-135	3	1
α-helix	138-149	12
α-helix	152-161	10
α-helix	163-174	12
α-helix	176-179	4
β-strand	183	1	2
β-strand	186-195	10	3
β-strand	198-208	11	3
β-strand	209	1	2
β-strand	214-219	6	4
β-strand	222-223	2	4
α-helix	225-227	3
β-strand	229-230	2	3
α-helix	231-233	3
β-strand	234-235	2	3
β-strand	241-249	9	3
β-strand	257-262	6	4
β-strand	270-272	3	4

Chain B: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	5
α-helix	6-7	2
β-strand	8-13	6	6
β-strand	23-32	10	6
β-strand	33	1	5
β-strand	38-43	6	7
β-strand	46-47	2	7
β-strand	51-52	2	6
β-strand	56-57	2	6
β-strand	63-71	9	6
β-strand	79-84	6	7
β-strand	92-95	4	7

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MHC class I antigen	A	protein	275	Sus scrofa	A0A0F6N4U7 (AlphaFold model)
Beta-2-microglobulin	B	protein	99	Sus scrofa	Q07717 (AlphaFold model)
peptide	C	protein	9	Foot-and-mouth disease virus	P03311

Sequence of entity 1 (A), FASTA

>6KWK_1 MHC class I antigen (chains A)
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDNYAPNPRMEPRVPWIQQEGQEYW
DRETRNVKETAQTYGVGLNTLRGYYNQSEAGSHTLQSMYGCYLGPDGLLLHGYRQDAYDG
ADYIALNEDLRSWTAADMAAQITKRKWEAADEAERRRSYLQGLCVESLRRYLEMGKDTLQ
RAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGT
FQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD

Sequence of entity 2 (B), FASTA

>6KWK_2 Beta-2-microglobulin (chains B)
FVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDW
SFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH

Sequence of entity 3 (C), FASTA

>6KWK_3 peptide (chains C)
MTAHITVPY

Primary citation

Peptidomes and Structures Illustrate Two Distinguishing Mechanisms of Alternating the Peptide Plasticity Caused by Swine MHC Class I Micropolymorphism. Wei, X., Wang, S., Li, Z. et al. Front Immunol (2021) 12:592447-592447. DOI 10.3389/fimmu.2021.592447 · PubMed

Other PDB entries of the same protein (UniProt A0A0F6N4U7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KWL 1.8 Å, Crystal structure of pSLA-1*0401(R156A) complex with FMDV-derived epitope MTAHITVPY

Browse structure collections

About this viewer

MolViewer shows 6KWK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.