6L4G: Human NDRG3 I171M/S176H mutant

Crystal structure of human NDRG3 I171M/S176H mutant. Determined by X-ray diffraction at 3.3 Å resolution. Released 26 Aug 2020.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,350
Mol. weight: 83.04 kDa
Released: 26 Aug 2020

Explore 6L4G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6L4G contains 37 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	31-36	6	1
β-strand	41-47	7	1
β-strand	56-60	5	1
α-helix	61-62	2
α-helix	67	1
α-helix	68-72	5
α-helix	73-76	4
α-helix	78-86	9
β-strand	89-93	5	1
α-helix	94	1
α-helix	101-105	5
α-helix	110-112	3
α-helix	113-118	6
α-helix	120-126	7
β-strand	132-137	6	1
α-helix	139-150	12
β-strand	155-161	7	1
α-helix	185-193	9
α-helix	196-200	5
α-helix	204-216	13
α-helix	221-230	10
α-helix	232-234	3
β-strand	255-261	7	1
α-helix	267-275	9
β-strand	282-287	6	1
α-helix	294-297	4
α-helix	299-313	15

Chain B: 18 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	30-37	8	2
β-strand	40-47	8	2
β-strand	56-60	5	2
α-helix	67	1
α-helix	68-72	5
α-helix	73-75	3
α-helix	78-84	7
β-strand	89-93	5	2
α-helix	94	1
α-helix	101-105	5
α-helix	110-112	3
α-helix	113-118	6
α-helix	120-126	7
β-strand	132-137	6	2
α-helix	139-150	12
α-helix	152-154	3
β-strand	155-161	7	2
α-helix	185-193	9
α-helix	196-201	6
α-helix	204-216	13
α-helix	219-230	12
α-helix	232-234	3
β-strand	255-261	7	2
α-helix	267-275	9
β-strand	284-287	4	2
α-helix	299-313	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein NDRG3	A, B	protein	375	Homo sapiens	Q9UGV2 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6L4G_1 Protein NDRG3 (chains A, B)
MDELQDVQLTEIKPLLNDKNGTRNFQDFDCQEHDIETTHGVVHVTIRGLPKGNRPVILTY
HDIGLNHKSCFNAFFNFEDMQEITQHFAVCHVDAPGQQEGAPSFPTGYQYPTMDELAEML
PPVLTHLSLKSIIGIGVGAGAYILSRFALNHPELVEGLVLINVDPCAKGWMDWAAHKLSG
LTTNVVDIILAHHFGQEELQANLDLIQTYRMHIAQDINQDNLQLFLNSYNGRRDLEIERP
ILGQNDNKSKTLKCSTLLVVGDNSPAVEAVVECNSRLNPINTTLLKMADCGGLPQVVQPG
KLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSLGSGESPFSRSVTSNQSDGTQESCE
SPDVLDRHQTMEVSC

Primary citation

Structural and Biophysical Analyses of Human N-Myc Downstream-Regulated Gene 3 (NDRG3) Protein. Kim, K.R., Kim, K.A., Park, J.S. et al. Biomolecules (2020) 10. DOI 10.3390/biom10010090 · PubMed

Other PDB entries of the same protein (UniProt Q9UGV2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L4B 2.2 Å, Crystal structure of human WT NDRG3
9KCL 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1-AMPPCP…
9KCM 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 and TMX2 in…
9KCR 3.2 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1 state
6L4H 3.4 Å, Crystal structure of human NDRG3 C30S mutant

Browse structure collections

About this viewer

MolViewer shows 6L4G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.