6LA5: Echovirus 11
Cryo-EM structure of echovirus 11 complexed with its attaching receptor CD55 at pH 7.4. Determined by electron microscopy at 2.86 Å resolution. Released 7 Oct 2020.
- Method
- Electron microscopy
- Resolution
- 2.86 Å
- Organisms
- Echovirus E11, Homo sapiens
- Chains
- 5
- Atoms
- 7,466
- Mol. weight
- 107.69 kDa
- Ligands
- SPH
- Released
- 7 Oct 2020
Explore 6LA5 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6LA5 contains 30 α-helices and 79 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 12 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-6 | 3 | 1 |
| α-helix | 7-8 | 2 | |
| β-strand | 13 | 1 | 2 |
| α-helix | 14-16 | 3 | |
| β-strand | 17 | 1 | 3 |
| β-strand | 31-32 | 2 | 4 |
| α-helix | 34-36 | 3 | |
| α-helix | 44-47 | 4 | |
| β-strand | 53 | 1 | 3 |
| β-strand | 58 | 1 | 2 |
| α-helix | 64-68 | 5 | |
| β-strand | 72-80 | 9 | 5 |
| β-strand | 90-94 | 5 | 6 |
| α-helix | 101-107 | 7 | |
| β-strand | 110-127 | 18 | 5 |
| α-helix | 128-129 | 2 | |
| β-strand | 141-147 | 7 | 6 |
| α-helix | 161-163 | 3 | |
| β-strand | 169-173 | 5 | 6 |
| α-helix | 178-179 | 2 | |
| β-strand | 180-183 | 4 | 5 |
| β-strand | 192-193 | 2 | 5 |
| β-strand | 198 | 1 | 7 |
| β-strand | 201 | 1 | 8 |
| β-strand | 205 | 1 | 8 |
| α-helix | 210-213 | 4 | |
| β-strand | 218-223 | 6 | 6 |
| β-strand | 232-250 | 19 | 5 |
| α-helix | 252-253 | 2 | |
| β-strand | 254 | 1 | 9 |
| α-helix | 257-258 | 2 | |
Chain B: 6 helices, 22 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 14-18 | 5 | 10 |
| β-strand | 21-25 | 5 | 10 |
| β-strand | 32-33 | 2 | 11 |
| α-helix | 52-53 | 2 | |
| β-strand | 54 | 1 | 11 |
| β-strand | 64-70 | 7 | 11 |
| β-strand | 78-82 | 5 | 12 |
| α-helix | 92-98 | 7 | |
| β-strand | 99-111 | 13 | 11 |
| β-strand | 121-128 | 8 | 12 |
| β-strand | 134 | 1 | 13 |
| β-strand | 148 | 1 | 14 |
| β-strand | 151 | 1 | 14 |
| α-helix | 152 | 1 | |
| β-strand | 153-154 | 2 | 12 |
| β-strand | 156 | 1 | 15 |
| β-strand | 166 | 1 | 13 |
| β-strand | 169 | 1 | 15 |
| α-helix | 170-172 | 3 | |
| β-strand | 177 | 1 | 9 |
| α-helix | 181-184 | 4 | |
| β-strand | 187-191 | 5 | 12 |
| β-strand | 197-202 | 6 | 11 |
| β-strand | 211 | 1 | 11 |
| β-strand | 216 | 1 | 7 |
| β-strand | 219-227 | 9 | 12 |
| β-strand | 240-255 | 16 | 11 |
| α-helix | 258-259 | 2 | |
Chain C: 7 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-7 | 2 | |
| β-strand | 23 | 1 | 5 |
| α-helix | 30-33 | 4 | |
| β-strand | 39-40 | 2 | 5 |
| β-strand | 52 | 1 | 4 |
| α-helix | 65-68 | 4 | |
| β-strand | 70-73 | 4 | 4 |
| β-strand | 81-86 | 6 | 16 |
| α-helix | 99-104 | 6 | |
| β-strand | 107-111 | 5 | 17 |
| β-strand | 114-120 | 7 | 4 |
| β-strand | 127 | 1 | 18 |
| β-strand | 129-135 | 7 | 16 |
| α-helix | 140-142 | 3 | |
| α-helix | 145-148 | 4 | |
| β-strand | 152-157 | 6 | 16 |
| α-helix | 158 | 1 | |
| β-strand | 163-168 | 6 | 4 |
| β-strand | 177-178 | 2 | 17 |
| β-strand | 189-194 | 6 | 16 |
| β-strand | 199 | 1 | 18 |
| β-strand | 207-216 | 10 | 4 |
| β-strand | 221-225 | 5 | 17 |
Chain D: 2 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 1 |
| β-strand | 26-29 | 4 | 1 |
| α-helix | 36-38 | 3 | |
| α-helix | 50-52 | 3 | |
| β-strand | 57 | 1 | 11 |
Chain E: 3 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 19 |
| α-helix | 7-9 | 3 | |
| β-strand | 16-19 | 4 | 20 |
| β-strand | 25 | 1 | 19 |
| β-strand | 29-34 | 6 | 20 |
| β-strand | 38-41 | 4 | 21 |
| β-strand | 45-47 | 3 | 20 |
| β-strand | 48-51 | 4 | 22 |
| β-strand | 54-57 | 4 | 22 |
| β-strand | 63-66 | 4 | 21 |
| α-helix | 67 | 1 | |
| β-strand | 69 | 1 | 23 |
| α-helix | 70-74 | 5 | |
| β-strand | 78-80 | 3 | 24 |
| β-strand | 87 | 1 | 23 |
| β-strand | 92-94 | 3 | 25 |
| β-strand | 95-97 | 3 | 24 |
| β-strand | 102-104 | 3 | 26 |
| β-strand | 108-110 | 3 | 25 |
| β-strand | 112-114 | 3 | 27 |
| β-strand | 117-119 | 3 | 27 |
| β-strand | 126-128 | 3 | 26 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Capsid protein VP1 | A | protein | 285 | Echovirus E11 | Q2LJ73 |
| Capsid protein VP2 | B | protein | 251 | Echovirus E11 | A0A0R5YS56 |
| Capsid protein VP3 | C | protein | 238 | Echovirus E11 | A0A346I7K2 |
| Capsid protein VP4 | D | protein | 69 | Echovirus E11 | E0WN77 |
| Complement decay-accelerating factor | E | protein | 125 | Homo sapiens | P08174 |
Sequence of entity 1 (A), FASTA
>6LA5_1 Capsid protein VP1 (chains A)
VVEAVENAVARVADTISSGPSNSQAVPALTAVETGHTSQVTPSDTIQTRHVRNYHSRSES
SIENFLCRSACVYMGEYHTTNTDTSKLFASWTINARRMVQMRRKLELFTYVRFDMEVTFV
ITSKQDQGTQLGQDMPPLTHQIMYIPPGGPIPKSVTDYTWQTSTNPSIFWTEGNAPPRMS
IPFISIGNAYSNFYDGWSHFSQNGVYGYNTLNHMGQIYVRHVNGSSPLPMTSTVRMYFKP
KHVKVWVPRPPRLCQYKNASTVNFTPTNITEKRQSINYIPETVKP
Sequence of entity 2 (B), FASTA
>6LA5_2 Capsid protein VP2 (chains B)
DRVRSITLGNSTITTQESANVVVAYGRWPEYLKDNEATAEDQPTQPDVATCRFYTLESVT
WERDSPGWWWKFPDALKDMGLFGQNMYYHYLGRAGYTIHVQCNASKFHQGCLMVVCVPEA
EMGCSQVDGTVNEHSLSEGETAKKFASTSTNGTNTVQSIVTNAGMGVGVGNLTIFPHQWI
NLRTNNCATIVMPYINNVPMDNMFRHHNFTLMIIPFVPLDYSSDSSTYVPITVTVAPMCA
EYNGLRLATSL
Sequence of entity 3 (C), FASTA
>6LA5_3 Capsid protein VP3 (chains C)
GLPVMNTPGSNQFLTSDDFQSPSAMPQFDVTPELNIPGEVQNLMEIAEVDSVVPVNNVEG
KLDTMEIYRIPVQSGNHQSSQVFGFQVQPGLDNVFKHTLLGEILNYYAHWSGSIKLTFVF
CGSAMATGKFLLAYAPPGANAPKSRKDAMLGTHIIWDVGLQSSCVLCIPWISQTHYRLVQ
QDEYTSAGNVTCWYQTGIVVPAGTPTSCSIMCFVSACNDFSVRLLKDTPFIEQSALLQ
Sequence of entity 4 (D), FASTA
>6LA5_4 Capsid protein VP4 (chains D)
MGAQVSTQKTGAHETGLNASGRSIIHYTNINYYKDAASNSANRQDFSQDPGKFTEPVKDI
MVKSLPALN
Sequence of entity 5 (E), FASTA
>6LA5_5 Complement decay-accelerating factor (chains E)
KSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPEC
REIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPP
PECRG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| SPH | Sphingosine | C18 H37 N O2 | 1 |
Primary citation
Molecular and structural basis of Echovirus 11 infection by using the dual-receptor system of CD55 and FcRn. Niu, S., Liu, C., Liu, C. et al. Chin Sci Bull (2020). DOI 10.1360/TB-2019-0786
Other PDB entries of the same protein (UniProt Q2LJ73), best resolution first:
- 6LA3 2.32 Å, Cryo-EM structure of full echovirus 11 particle at pH 7.4
- 6LA4 2.34 Å, Cryo-EM structure of full echovirus 11 particle at pH 5.5
- 6LA6 2.39 Å, Cryo-EM structure of echovirus 11 complexed with its uncoating receptor FcRn at pH 7.4
- 6LAP 2.49 Å, Cryo-EM structure of echovirus 11 A-particle at pH 7.4
- 6LB1 2.58 Å, Cryo-EM structure of echovirus 11 A-particle at pH 5.5
- 6LBQ 2.6 Å, Cryo-EM structure of echovirus 11 empty particle at pH 5.5
- 6LAO 2.64 Å, Cryo-EM structure of echovirus 11 complexed with its attaching receptor CD55 at pH 5.5
- 6LA7 2.82 Å, Cryo-EM structure of echovirus 11 complexed with its uncoating receptor FcRn at pH 5.5
- 6LBO 3.18 Å, Cryo-EM structure of echovirus 11 empty particle at pH 7.4
Browse structure collections
About this viewer
MolViewer shows 6LA5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.