6LES: PDB entry 6LES

3D domain-swapped dimer of the maltose-binding protein fused to a fragment of the focal adhesion kinase. Determined by X-ray diffraction at 2.0 Å resolution. Released 11 Dec 2019.

Method

X-ray diffraction

Resolution

2.0 Å

Organisms

Escherichia coli (strain K12), Homo sapiens

Chains

4

Atoms

11,755

Mol. weight

175.61 kDa

Released

11 Dec 2019

Explore 6LES in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6LES contains 92 α-helices and 96 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 24 β-strands

Molecules and chains

>6LES_1 Maltose/maltodextrin-binding periplasmic protein,Focal adhesion kinase 1 (chains A, B, X, Y)
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI
IFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK
DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIK
DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSA
VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL
GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDA
ALAAAQTNATHLMEERLIRQQQEMEEDQRWLEKEERF

Primary citation

Passenger sequences can promote interlaced dimers in a common variant of the maltose-binding protein. Momin, A.A., Hameed, U.F.S., Arold, S.T. Sci Rep (2019) 9:20396-20396. DOI 10.1038/s41598-019-56718-y · PubMed

Related structures

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 8C8F 1.15 Å, Crystal structure of the E. coli maltodextrin-binding protein
• 4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
• 3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
• 7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
• 5M13 1.37 Å, Synthetic nanobody in complex with MBP
• 5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
• 5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
• 6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
• 4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
• 8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
• 3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
• 9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan

Browse structure collections

About this viewer

MolViewer shows 6LES directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.