Crystal structure of Arabidopsis ARID5 ARID-PHD cassette in complex with H3K4me3 peptide and DNA. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Jun 2020.
Explore 6LQF in 3D Show helices and sheets RCSB PDB PDBe
6LQF contains 13 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 561-563 | 3 | |
| α-helix | 569-582 | 14 | |
| α-helix | 586-588 | 3 | |
| α-helix | 593-596 | 4 | |
| β-strand | 601-602 | 2 | 1 |
| β-strand | 605-606 | 2 | 1 |
| α-helix | 609-617 | 9 | |
| α-helix | 622-627 | 6 | |
| α-helix | 630-634 | 5 | |
| α-helix | 635-637 | 3 | |
| α-helix | 650-661 | 12 | |
| α-helix | 663-667 | 5 | |
| α-helix | 675-677 | 3 | |
| β-strand | 687-690 | 4 | 2 |
| β-strand | 697-699 | 3 | 2 |
| α-helix | 700-702 | 3 | |
| α-helix | 711-715 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-5 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AT-rich interactive domain-containing protein 4 | A | protein | 204 | Arabidopsis thaliana | Q6NQ79 (AlphaFold model) |
| 15-mer peptide from Histone H3.2 | P | protein | 15 | Arabidopsis thaliana | P59226 (AlphaFold model) |
| DNA (5'-d(*tp*tp*tp*ap*gp*ap*tp*cp*tp*ap*ap*a)-3') | B, C | DNA | 12 | synthetic construct |
>6LQF_1 AT-rich interactive domain-containing protein 4 (chains A) SQIISLNPLPLKKHDCGRAHIQVCSEEEFLRDVMQFLLIRGHTRLVPPGGLAEFPDAVLN SKRLDLFNLYREVVSRGGFHVGNGINWKGQVFSKMRNHTLTNRMTGVGNTLKRHYETYLL EYEYAHDDVDGECCLICRSSTAGDWVNCGSCGEWAHFGCDRRPGLGAFKDYAKTDGLEYV CPNCSVSNYRKKSQKTSNGGLLVP
>6LQF_2 15-mer peptide from Histone H3.2 (chains P) ARTKQTARKSTGGKA
>6LQF_3 DNA (5'-D(*TP*TP*TP*AP*GP*AP*TP*CP*TP*AP*AP*A)-3') (chains B, C) TTTAGATCTAAA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Dual Recognition of H3K4me3 and DNA by the ISWI Component ARID5 Regulates the Floral Transition in Arabidopsis. Tan, L.M., Liu, R., Gu, B.W. et al. Plant Cell (2020) 32:2178-2195. DOI 10.1105/tpc.19.00944 · PubMed
Other PDB entries of the same protein (UniProt Q6NQ79 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6LQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.