Crystal structure of Keap1 in complex with dimethyl fumarate (DMF). Determined by X-ray diffraction at 1.54 Å resolution. Released 5 Aug 2020.
Explore 6LRZ in 3D Show helices and sheets RCSB PDB PDBe
6LRZ contains 7 α-helices and 42 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 321 | 1 | 1 |
| β-strand | 324 | 1 | 1 |
| β-strand | 326-331 | 6 | 2 |
| β-strand | 334-335 | 2 | 3 |
| β-strand | 337-338 | 2 | 3 |
| β-strand | 342-345 | 4 | 2 |
| β-strand | 352-354 | 3 | 2 |
| α-helix | 356-358 | 3 | |
| β-strand | 363 | 1 | 4 |
| β-strand | 366-370 | 5 | 5 |
| β-strand | 373-377 | 5 | 5 |
| β-strand | 380-383 | 4 | 4 |
| β-strand | 386-389 | 4 | 4 |
| β-strand | 393-397 | 5 | 5 |
| β-strand | 402-405 | 4 | 5 |
| α-helix | 407-409 | 3 | |
| β-strand | 414 | 1 | 6 |
| β-strand | 417-421 | 5 | 7 |
| β-strand | 424-428 | 5 | 7 |
| β-strand | 431-432 | 2 | 6 |
| β-strand | 435-436 | 2 | 6 |
| β-strand | 440-444 | 5 | 7 |
| β-strand | 449-452 | 4 | 7 |
| α-helix | 454-456 | 3 | |
| β-strand | 461 | 1 | 8 |
| β-strand | 464-468 | 5 | 8 |
| β-strand | 471-478 | 8 | 8 |
| β-strand | 483-491 | 9 | 8 |
| α-helix | 492-494 | 3 | |
| β-strand | 496-499 | 4 | 8 |
| α-helix | 501-503 | 3 | |
| β-strand | 508 | 1 | 9 |
| β-strand | 511-515 | 5 | 10 |
| β-strand | 518-522 | 5 | 10 |
| β-strand | 525 | 1 | 9 |
| β-strand | 530 | 1 | 9 |
| β-strand | 534-538 | 5 | 10 |
| β-strand | 543-547 | 5 | 10 |
| α-helix | 548-550 | 3 | |
| β-strand | 555 | 1 | 11 |
| β-strand | 558-562 | 5 | 12 |
| β-strand | 565-569 | 5 | 12 |
| β-strand | 572 | 1 | 11 |
| β-strand | 577 | 1 | 11 |
| β-strand | 580-585 | 6 | 12 |
| β-strand | 590-596 | 7 | 12 |
| β-strand | 602 | 1 | 3 |
| β-strand | 605-610 | 6 | 2 |
| α-helix | 611-612 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Keap1-DC | A | protein | 314 | Mus musculus | Q9Z2X8 (AlphaFold model) |
>6LRZ_1 Keap1-DC (chains A) MGSSHHHHHHSSGLVPRGSHMVGRLIYTAGGYFRQSLSYLEAYNPSNGSWLRLADLQVPR SGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCASMSVPRNRIGVGVID GHIYAVGGSHGCIHHSSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTN RLNSAECYYPERNEWRMITPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETE TWTFVAPMRHHRSALGITVHQGKIYVLGGYDGHTFLDSVECYDPDSDTWSEVTRMTSGRS GVGVAVTMEPCRKQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| EOU | dimethyl (~{E})-but-2-enedioate | C6 H8 O4 | 3 |
| PG5 | 1-methoxy-2-[2-(2-methoxy-ethoxy]-ethane | C8 H18 O4 | 1 |
Water and common crystallization additives (ACT, SO4) are not listed.
Structural insights into the multiple binding modes of Dimethyl Fumarate (DMF) and its analogs to the Kelch domain of Keap1. Unni, S., Deshmukh, P., Krishnappa, G. et al. FEBS J (2021) 288:1599-1613. DOI 10.1111/febs.15485 · PubMed
Other PDB entries of the same protein (UniProt Q9Z2X8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6LRZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.