6M3R: AnkG/beta4-spectrin complex

Crystal structure of AnkG/beta4-spectrin complex. Determined by X-ray diffraction at 4.31 Å resolution. Released 13 May 2020.

Method: X-ray diffraction
Resolution: 4.31 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 2
Atoms: 4,999
Mol. weight: 91.44 kDa
Released: 13 May 2020

Explore 6M3R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M3R contains 21 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain E: 12 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	971-974	4	1
β-strand	979-982	4	2
α-helix	983	1
β-strand	990-993	4	2
β-strand	1002-1005	4	1
β-strand	1006-1009	4	3
α-helix	1017-1019	3
β-strand	1025-1026	2	3
β-strand	1030-1033	4	3
β-strand	1039-1049	11	2
β-strand	1052	1	4
β-strand	1059-1066	8	3
β-strand	1073-1074	2	3
α-helix	1083-1086	4
α-helix	1098-1104	7
β-strand	1106-1113	8	2
β-strand	1117-1124	8	3
β-strand	1126-1129	4	5
α-helix	1150-1151	2
β-strand	1161-1166	6	5
α-helix	1170-1173	4
β-strand	1186-1189	4	5
β-strand	1195-1205	11	6
α-helix	1206-1207	2
β-strand	1225-1230	6	5
α-helix	1237-1238	2
β-strand	1241-1242	2	5
β-strand	1250-1252	3	6
β-strand	1255-1262	8	6
β-strand	1265-1270	6	5
α-helix	1276-1288	13
α-helix	1291	1
β-strand	1292-1301	10	4
β-strand	1311-1316	6	4
α-helix	1324-1328	5
β-strand	1332-1343	12	4
β-strand	1347-1353	7	7
α-helix	1357-1359	3
β-strand	1367-1369	3	7
β-strand	1379	1	4
β-strand	1393-1398	6	7
β-strand	1413-1417	5	7

Chain F: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	1591-1607	17
α-helix	1616-1634	19
α-helix	1640-1648	9
α-helix	1665-1714	50
α-helix	1722-1760	39
α-helix	1765-1819	55
α-helix	1821-1824	4
α-helix	1837-1865	29
α-helix	1871-1895	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin-3	E	protein	491	Rattus norvegicus	O70511 (AlphaFold model)
Spectrin beta chain	F	protein	322	Mus musculus	E9PX29 (AlphaFold model)

Sequence of entity 1 (E), FASTA

>6M3R_1 Ankyrin-3 (chains E)
ADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVK
RHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGE
TWKEHQFDSKNEDLSELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQ
IGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVE
PRRRKFHKPITMTIPVPPPSGEGVSNGYKGDTTPSLRLLCSITGGTSPAQWEDITGTTPL
TFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVES
SLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFN
FYSFKENRLPFSIKVRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKAD
RRQSFTSLALR

Sequence of entity 2 (F), FASTA

>6M3R_2 Spectrin beta chain (chains F)
AFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQ
LSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDEL
EHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGH
TAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPR
LTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQE
VLQGWKELLAACEDARLHVSST

Primary citation

Structural Basis Underlying Strong Interactions between Ankyrins and Spectrins. Li, J., Chen, K., Zhu, R. et al. J Mol Biol (2020) 432:3838-3850. DOI 10.1016/j.jmb.2020.04.023 · PubMed

Other PDB entries of the same protein (UniProt O70511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YIP 1.85 Å, Crystal Structure of AnkG LIR/GABARAPL1 complex
6A9X 2.2 Å, Crystal Structure of AnkG/GABARAP Complex
7XCE 2.5 Å, Crystal structure of Ankyrin G in complex with neurofascin
5YIQ 2.6 Å, Crystal structure of AnkG LIR/LC3B complex
6M3P 3.31 Å, Crystal structure of AnkG/beta2-spectrin complex

Browse structure collections

About this viewer

MolViewer shows 6M3R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.