6M49: Insulin-induced gene 2 protein

cryo-EM structure of Scap/Insig complex in the present of 25-hydroxyl cholesterol. Determined by electron microscopy at 3.7 Å resolution. Released 20 Jan 2021.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,098
Mol. weight: 88.45 kDa
Ligands: HC3
Released: 20 Jan 2021

Explore 6M49 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M49 contains 20 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	19-50	32
α-helix	62-66	5
α-helix	73-95	23
α-helix	105-121	17
α-helix	131-148	18
α-helix	154-172	19
α-helix	187-189	3
α-helix	191-213	23

Chain B: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	7-24	18
α-helix	27-46	20
α-helix	286-304	19
α-helix	314-337	24
α-helix	345-356	12
α-helix	359-369	11
α-helix	379-386	8
α-helix	389-407	19
α-helix	412-431	20
α-helix	432-437	6
α-helix	438-448	11
α-helix	537-555	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin-induced gene 2 protein	A	protein	225	Homo sapiens	Q9Y5U4 (AlphaFold model)
Sterol regulatory element-binding protein cleavage-activating protein,Sterol regulatory…	B	protein	572	Homo sapiens	Q12770 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6M49_1 Insulin-induced gene 2 protein (chains A)
MAEGETESPGPKKSGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPP
DVIASIFSSAWWVPPCCGTASAVIGLLYPSIDRHLGEPHKFKREWSSVMRCVAVFVGINH
ASAKVDFDNNIQLSLTLAALSIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQY
TSPDFLYVRSWLPCIFFAGGITMGNIGRQLAMYESKVIAEKSHQE

Sequence of entity 2 (B), FASTA

>6M49_2 Sterol regulatory element-binding protein cleavage-activating protein,Sterol regulatory element-binding protein cleavage-activating protein (chains B)
MTLTERLREKISRAFYNHGLLCASYPIPIILFTGFCILACCYPLLKLPLPGTVPGKYSGV
SLYTRKRMVSYTITLVFQHYHAKFLGSLRARLMLLHPSPNCSLRAESLVHVHFKEEIGVA
ELIPLVTTYIILFAYIYFSTRKIDMVKSKWGLALAAVVTVLSSLLMSVGLCTLFGLTPTL
NGGEIFPYLVVVIGLENVLVLTKSVVSTPVDLEVKLRIAQGLSSESWSIMKNMATELGII
LIGYFTLVPAIQEFCLFAVVGLVSDFFLQMLFFTTVLSIDIRRMELADLNKRLPPEACLP
SAKPVGQPTRYERQLAVRPSTPHTITLQPSSFRNLRLPKRLRVVYFLARTRLAQRLIMAG
TVVWIGILVYTDPAGLRNYLAAQVTEQSPLGEGALAPMPVPSGMLPPSHPDPAFSIFPPD
APKLPENQTSPGESPERGGPAEVVHDSPVPEVTWGPEDEELWRKLSFRHWPTLFSYYNIT
LAKRYISLLPVIPVTLRLNPREALEGRHPQDGRSAWPPPGPIPAGHWEAGPKGPGGVQAH
GDVTLYKVAALGLATGIVLVLLLLCLYRVLCP

Ligands and cofactors

ID	Name	Formula	Copies
HC3	25-hydroxycholesterol	C27 H46 O2	1

Primary citation

A structure of human Scap bound to Insig-2 suggests how their interaction is regulated by sterols. Yan, R., Cao, P., Song, W. et al. Science (2021) 371. DOI 10.1126/science.abb2224 · PubMed

Other PDB entries of the same protein (UniProt Q9Y5U4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J82 1.46 Å, Crystal structure of beta'-COP/Insig-2 complex
7ETW 4.1 Å, Cryo-EM structure of Scap/Insig complex in the present of digitonin.

Browse structure collections

About this viewer

MolViewer shows 6M49 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.