X-ray crystal structure of wild type HIV-1 protease in complex with GRL-001. Determined by X-ray diffraction at 1.48 Å resolution. Released 24 Apr 2019.
Explore 6MCR in 3D Show helices and sheets RCSB PDB PDBe
6MCR contains 2 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 10-15 | 6 | 1 |
| β-strand | 18-24 | 7 | 1 |
| β-strand | 32-33 | 2 | 1 |
| β-strand | 43-49 | 7 | 1 |
| β-strand | 52-66 | 15 | 1 |
| β-strand | 69-77 | 9 | 1 |
| β-strand | 84-85 | 2 | 1 |
| α-helix | 87-90 | 4 | |
| α-helix | 91-93 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protease | A | protein | 99 | Human immunodeficiency virus 1 | P12497 |
>6MCR_1 Protease (chains A) PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| JDY | (3S,3aR,5R,7aS,8S)-hexahydro-4H-3,5-methanofuro[2,3-b]pyran-8-yl… | C33 H41 F N4 O7 S2 | 1 |
Water and common crystallization additives (EDO) are not listed.
Halogen Bond Interactions of Novel HIV-1 Protease Inhibitors (PI) (GRL-001-15 and GRL-003-15) with the Flap of Protease Are Critical for Their Potent Activity against Wild-Type HIV-1 and Multi-PI-Resistant Variants. Hattori, S.I., Hayashi, H., Bulut, H. et al. Antimicrob Agents Chemother (2019) 63. DOI 10.1128/AAC.02635-18 · PubMed
Other PDB entries of the same protein (UniProt P12497), best resolution first:
MolViewer shows 6MCR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.