6MEW: RFXANK ankyrin repeats

RFXANK ankyrin repeats in complex with a RFX7 peptide. Determined by X-ray diffraction at 1.78 Å resolution. Released 3 Oct 2018.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,080
Mol. weight: 41.85 kDa
Released: 3 Oct 2018

Explore 6MEW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MEW contains 22 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	94-99	6
α-helix	103-112	10
α-helix	127-133	7
α-helix	137-146	10
α-helix	160-166	7
α-helix	170-177	8
α-helix	193-199	7
α-helix	203-211	9
α-helix	226-232	7
α-helix	236-248	13

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	90-94	5

Chain C: 10 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	94-99	6
α-helix	103-112	10
α-helix	127-134	8
α-helix	137-146	10
β-strand	153	1	1
β-strand	159	1	1
α-helix	160-166	7
α-helix	170-177	8
α-helix	193-199	7
α-helix	203-211	9
α-helix	226-233	8
α-helix	236-249	14

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	90-95	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-binding protein RFXANK	A, C	protein	172	Homo sapiens	O14593 (AlphaFold model)
RFX7 peptide	B, D	protein	17	Homo sapiens	Q2KHR2 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>6MEW_1 DNA-binding protein RFXANK (chains A, C)
GDSLSIHQLAAQGELDQLKEHLRKGDNLVNKPDERGFTPLIWASAFGEIETVRFLLEWGA
DPHILAKERESALSLASTGGYTDIVGLLLERDVDINIYDWNGGTPLLYAVRGNHVKCVEA
LLARGADLTTEADSGYTPMDLAVALGYRKVQQVIENHILKLFQSNLVPADPE

Sequence of entity 2 (B, D), FASTA

>6MEW_2 RFX7 peptide (chains B, D)
KAFVHMPTLPNLDFHKT

Primary citation

RFXANK ankyrin repeats in complex with a RFX7 peptide. Tempel, W., Xu, C., Dong, A. et al. To be published.

Other PDB entries of the same protein (UniProt O14593 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V30 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
3UXG 1.85 Å, Crystal structure of RFXANK

Browse structure collections

About this viewer

MolViewer shows 6MEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.