Crystal structure of the polo-box domain of Cdc5 from budding yeast. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Feb 2020.
Explore 6MF4 in 3D Show helices and sheets RCSB PDB PDBe
6MF4 contains 9 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 464-465 | 2 | 1 |
| α-helix | 471-497 | 27 | |
| α-helix | 504-508 | 5 | |
| α-helix | 510-512 | 3 | |
| β-strand | 514-518 | 5 | 2 |
| β-strand | 526-530 | 5 | 2 |
| β-strand | 535-538 | 4 | 2 |
| β-strand | 544-547 | 4 | 2 |
| β-strand | 553-560 | 8 | 2 |
| β-strand | 564-571 | 8 | 2 |
| α-helix | 572-574 | 3 | |
| α-helix | 577-579 | 3 | |
| α-helix | 580-593 | 14 | |
| β-strand | 615-620 | 6 | 1 |
| β-strand | 624-629 | 6 | 1 |
| β-strand | 634-638 | 5 | 1 |
| β-strand | 643-647 | 5 | 1 |
| β-strand | 652-656 | 5 | 1 |
| β-strand | 662-666 | 5 | 1 |
| α-helix | 667-673 | 7 | |
| α-helix | 680-682 | 3 | |
| α-helix | 684-698 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cell cycle serine/threonine-protein kinase CDC5/MSD2 | A | protein | 290 | Saccharomyces cerevisiae | P32562 (AlphaFold model) |
>6MF4_1 Cell cycle serine/threonine-protein kinase CDC5/MSD2 (chains A) GALSPGGTKQKYKEVVDIEAQRRLNDLAREARIRRAQQAVLRKELIATSTNVIKSEISLR ILASECHLTLNGIVEAEAQYKMGGLPKSRLPKIKHPMIVTKWVDYSNKHGFSYQLSTEDI GVLFNNGTTVLRLADAEEFWYISYDDREGWVASHYLLSEKPRELSRHLEVVDFFAKYMKA NLSRVSTFGREEYHKDDVFLRRYTRYKPFVMFELSDGTFQFNFKDHHKMAISDGGKLVTY ISPSHESTTYPLVEVLKYGEIPGYPESNFREKLTLIKEGLKQKSTIVTVD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Distinct surfaces on Cdc5/PLK Polo-box domain orchestrate combinatorial substrate recognition during cell division. Almawi, A.W., Langlois-Lemay, L., Boulton, S. et al. Sci Rep (2020) 10:3379-3379. DOI 10.1038/s41598-020-60344-4 · PubMed
Other PDB entries of the same protein (UniProt P32562 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6MF4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.