6MF8: TCR alpha transmembrane domain

TCR alpha transmembrane domain. Determined by solution NMR. Released 12 Dec 2018.

Method: Solution NMR
Organism: Mus musculus
Chains: 1
Atoms: 366
Mol. weight: 5.25 kDa
Released: 12 Dec 2018

Explore 6MF8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MF8 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	17-32	16
α-helix	33-37	5
α-helix	38-41	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-cell receptor alpha chain C region	A	protein	46	Mus musculus	P01849 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MF8_1 T-cell receptor alpha chain C region (chains A)
DATLTEKSFETDMNLNFQNLSVMGLRILLLKVAGFNLLMTLRLWSS

Primary citation

The T Cell Antigen Receptor alpha Transmembrane Domain Coordinates Triggering through Regulation of Bilayer Immersion and CD3 Subunit Associations. Brazin, K.N., Mallis, R.J., Boeszoermenyi, A. et al. Immunity (2018) 49:829-841.e6. DOI 10.1016/j.immuni.2018.09.007 · PubMed

Other PDB entries of the same protein (UniProt P01849 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M02 1.75 Å, Crystal structure of murine P14 TCR / H-2Db with PF, modified gp33 peptide from LCMV
2Q86 1.85 Å, Structure of the mouse invariant NKT cell receptor Valpha14
6G9Q 1.89 Å, Ternary complex of P14 TCR with murine MHC class I H-2 Db in complex with self-antigen…
5M01 1.95 Å, Crystal structure of murine P14 TCR/ H-2Db complex with PA, modified gp33 peptide from…
1LP9 2.0 Å, Xenoreactive complex AHIII 12.2 TCR bound to p1049/HLA-A2.1
8WTE 2.17 Å, Crystal structure of TCR in complex with HLA-A*11:01 bound to KRAS-G12V peptide…
8WUL 2.36 Å, Crystal structure of affinity enhanced TCR in complex with HLA-A*11:01 bound to…
2JCC 2.5 Å, AH3 recognition of mutant HLA-A2 W167A
1NFD 2.8 Å, An alpha-beta T cell receptor (TCR) heterodimer in complex with an anti-TCR FAB fragment…
2J8U 2.88 Å, Large CDR3a loop alteration as a function of MHC mutation.
3MBE 2.89 Å, TCR 21.30 in complex with MHC class II I-Ag7HEL(11-27)
3C6L 3.4 Å, Crystal structure of mouse MHC class II I-Ab/3K peptide complexed with mouse TCR 2W20

Browse structure collections

About this viewer

MolViewer shows 6MF8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.