6MKB: Murine 4-1BB ligand

Crystal structure of murine 4-1BB ligand. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Dec 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 5,706
Mol. weight: 80.94 kDa
Released: 19 Dec 2018

Explore 6MKB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MKB contains 16 α-helices and 70 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	148-153	6	1
α-helix	154-155	2
β-strand	156	1	2
β-strand	162-163	2	3
α-helix	164-165	2
β-strand	166-167	2	1
β-strand	169	1	4
β-strand	175	1	4
β-strand	177	1	1
β-strand	181-184	4	3
β-strand	189-192	4	3
β-strand	196-206	11	1
β-strand	207-208	2	5
β-strand	218-228	11	3
α-helix	230-231	2
β-strand	238-243	6	3
β-strand	253-263	11	1
β-strand	267-278	12	3
α-helix	283-286	4
β-strand	287-288	2	5
β-strand	289	1	2
β-strand	296-304	9	1

Chain C: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	148-153	6	10
α-helix	154-155	2
β-strand	156	1	11
β-strand	162-163	2	12
α-helix	164-165	2
β-strand	166-167	2	10
β-strand	176-177	2	10
β-strand	181-184	4	12
β-strand	189-192	4	12
β-strand	196-206	11	10
β-strand	207-208	2	13
β-strand	218-228	11	12
α-helix	230-231	2
β-strand	238-243	6	12
β-strand	253-263	11	10
β-strand	267-278	12	12
α-helix	283-286	4
β-strand	287-288	2	13
β-strand	289	1	11
β-strand	296-304	9	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor ligand superfamily member 9	A, B, C, D	protein	171	Mus musculus	P41274 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6MKB_1 Tumor necrosis factor ligand superfamily member 9 (chains A, B, C, D)
NTTQQGSPVFAKLLAKNQASLCNTTLNWHSQDGAGSSYLSQGLRYEEDKKELVVDSPGLY
YVFLELKLSPTFTNTGHKVQGWVSLVLQAKPQVDDFDNLALTVELFPCSMENKLVDRSWS
QLLLLKAGHRLSVGLRAYLHGAQDAYRDWELSYPNTTSFGLFLVKPDNPWE

Primary citation

Crystal structure of the m4-1BB/4-1BBL complex reveals an unusual dimeric ligand that undergoes structural changes upon 4-1BB receptor binding. Bitra, A., Doukov, T., Destito, G. et al. J Biol Chem (2019) 294:1831-1845. DOI 10.1074/jbc.RA118.006297 · PubMed

Other PDB entries of the same protein (UniProt P41274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MKZ 2.65 Å, Crystal structure of murine 4-1BB/4-1BBL complex

Browse structure collections

About this viewer

MolViewer shows 6MKB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.