Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 K2879A, S2813D phosphomimetic (2699-2904) crystal form 1. Determined by X-ray diffraction at 1.85 Å resolution. Released 8 May 2019.
Explore 6MM7 in 3D Show helices and sheets RCSB PDB PDBe
6MM7 contains 61 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 17-31 | 15 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-51 | 9 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 68-75 | 8 | 1 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 2 |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 115-121 | 7 | 1 |
| α-helix | 122 | 1 | |
| β-strand | 126-127 | 2 | 2 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 2 |
| β-strand | 180-182 | 3 | 2 |
| β-strand | 189-190 | 2 | 3 |
| β-strand | 195 | 1 | 4 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-211 | 5 | |
| β-strand | 215 | 1 | 4 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2704-2706 | 3 | |
| α-helix | 2710-2713 | 4 | |
| α-helix | 2714-2716 | 3 | |
| α-helix | 2717-2737 | 21 | |
| β-strand | 2741 | 1 | 5 |
| β-strand | 2747 | 1 | 5 |
| β-strand | 2752 | 1 | 5 |
| α-helix | 2759-2761 | 3 | |
| α-helix | 2764-2783 | 20 | |
| β-strand | 2787-2790 | 4 | 6 |
| α-helix | 2796-2799 | 4 | |
| α-helix | 2811-2816 | 6 | |
| α-helix | 2824-2826 | 3 | |
| α-helix | 2830-2833 | 4 | |
| α-helix | 2834-2862 | 29 | |
| α-helix | 2873-2875 | 3 | |
| α-helix | 2878-2897 | 20 | |
| β-strand | 2900-2903 | 4 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-31 | 16 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-51 | 9 | 7 |
| β-strand | 56-62 | 7 | 7 |
| β-strand | 68-75 | 8 | 7 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-95 | 11 | |
| β-strand | 103 | 1 | 8 |
| β-strand | 106-111 | 6 | 7 |
| β-strand | 115-121 | 7 | 7 |
| α-helix | 122 | 1 | |
| β-strand | 126-127 | 2 | 8 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 9 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 8 |
| β-strand | 180-182 | 3 | 8 |
| β-strand | 189-190 | 2 | 9 |
| β-strand | 195 | 1 | 10 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-211 | 5 | |
| β-strand | 215 | 1 | 10 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 277-279 | 3 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2704-2706 | 3 | |
| α-helix | 2710-2713 | 4 | |
| α-helix | 2714-2716 | 3 | |
| α-helix | 2717-2737 | 21 | |
| β-strand | 2741 | 1 | 11 |
| β-strand | 2747 | 1 | 11 |
| β-strand | 2752 | 1 | 11 |
| α-helix | 2759-2761 | 3 | |
| α-helix | 2764-2783 | 20 | |
| β-strand | 2787-2790 | 4 | 12 |
| α-helix | 2797-2799 | 3 | |
| α-helix | 2811-2816 | 6 | |
| α-helix | 2824-2826 | 3 | |
| α-helix | 2834-2862 | 29 | |
| α-helix | 2873-2875 | 3 | |
| α-helix | 2878-2897 | 20 | |
| β-strand | 2900-2903 | 4 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-dependent protein kinase catalytic subunit alpha | A, D | protein | 339 | Mus musculus | P05132 (AlphaFold model) |
| Ryanodine receptor 2 | C, E | protein | 209 | Mus musculus | E9Q401 |
>6MM7_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A, D) SNAVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAM KILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSH LRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIV SGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVE APFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
>6MM7_2 Ryanodine receptor 2 (chains C, E) SNANFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPL MKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVDID AAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDT LTAAEKAKDREKAQDIFKFLQISGYVVSR
| ID | Name | Formula | Copies |
|---|---|---|---|
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 2 |
Water and common crystallization additives (CL, EDO, ACY, FMT) are not listed.
cAMP-dependent protein kinase A in complex with RyR2 peptide (2799-2810). Haji-Ghassemi, O., Yuchi, Z., van Petegem, F. Mol Cell (2019).
Other PDB entries of the same protein (UniProt P05132 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6MM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.