6MM7: PDB entry 6MM7

Catalytic subunit of cAMP-dependent protein kinase A in complex with RyR2 K2879A, S2813D phosphomimetic (2699-2904) crystal form 1. Determined by X-ray diffraction at 1.85 Å resolution. Released 8 May 2019.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Mus musculus
Chains: 4
Atoms: 9,661
Mol. weight: 129.71 kDa
Ligands: ANP
Released: 8 May 2019

Explore 6MM7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MM7 contains 61 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	17-31	15
α-helix	40-42	3
β-strand	43-51	9	1
β-strand	56-62	7	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-95	11
β-strand	103	1	2
β-strand	106-111	6	1
β-strand	115-121	7	1
α-helix	122	1
β-strand	126-127	2	2
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	3
α-helix	169-171	3
β-strand	172-174	3	2
β-strand	180-182	3	2
β-strand	189-190	2	3
β-strand	195	1	4
α-helix	202-204	3
α-helix	207-211	5
β-strand	215	1	4
α-helix	218-233	16
α-helix	243-252	10
α-helix	263-272	10
α-helix	277-279	3
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-306	5
α-helix	311-312	2

Chain C: 13 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	2704-2706	3
α-helix	2710-2713	4
α-helix	2714-2716	3
α-helix	2717-2737	21
β-strand	2741	1	5
β-strand	2747	1	5
β-strand	2752	1	5
α-helix	2759-2761	3
α-helix	2764-2783	20
β-strand	2787-2790	4	6
α-helix	2796-2799	4
α-helix	2811-2816	6
α-helix	2824-2826	3
α-helix	2830-2833	4
α-helix	2834-2862	29
α-helix	2873-2875	3
α-helix	2878-2897	20
β-strand	2900-2903	4	6

Chain D: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	40-42	3
β-strand	43-51	9	7
β-strand	56-62	7	7
β-strand	68-75	8	7
α-helix	76-81	6
α-helix	85-95	11
β-strand	103	1	8
β-strand	106-111	6	7
β-strand	115-121	7	7
α-helix	122	1
β-strand	126-127	2	8
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	9
α-helix	169-171	3
β-strand	172-174	3	8
β-strand	180-182	3	8
β-strand	189-190	2	9
β-strand	195	1	10
α-helix	202-204	3
α-helix	207-211	5
β-strand	215	1	10
α-helix	218-233	16
α-helix	243-252	10
α-helix	263-272	10
α-helix	277-279	3
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-306	5
α-helix	311-312	2

Chain E: 12 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	2704-2706	3
α-helix	2710-2713	4
α-helix	2714-2716	3
α-helix	2717-2737	21
β-strand	2741	1	11
β-strand	2747	1	11
β-strand	2752	1	11
α-helix	2759-2761	3
α-helix	2764-2783	20
β-strand	2787-2790	4	12
α-helix	2797-2799	3
α-helix	2811-2816	6
α-helix	2824-2826	3
α-helix	2834-2862	29
α-helix	2873-2875	3
α-helix	2878-2897	20
β-strand	2900-2903	4	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase catalytic subunit alpha	A, D	protein	339	Mus musculus	P05132 (AlphaFold model)
Ryanodine receptor 2	C, E	protein	209	Mus musculus	E9Q401

Sequence of entity 1 (A, D), FASTA

>6MM7_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A, D)
SNAVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAM
KILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSH
LRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRV
KGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIV
SGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVE
APFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF

Sequence of entity 2 (C, E), FASTA

>6MM7_2 Ryanodine receptor 2 (chains C, E)
SNANFNPQPVDTSNITIPEKLEYFINKYAEHSHDKWSMDKLANGWIYGEIYSDSSKIQPL
MKPYKLLSEKEKEIYRWPIKESLKTMLAWGWRIERTREGDSMALYNRTRRISQTSQVDID
AAHGYSPRAIDMSNVTLSRDLHAMAEMMAENYHNIWAKKKKLELESKGGGNHPLLVPYDT
LTAAEKAKDREKAQDIFKFLQISGYVVSR

Ligands and cofactors

ID	Name	Formula	Copies
ANP	Phosphoaminophosphonic acid-adenylate ester	C10 H17 N6 O12 P3	2

Water and common crystallization additives (CL, EDO, ACY, FMT) are not listed.

Primary citation

cAMP-dependent protein kinase A in complex with RyR2 peptide (2799-2810). Haji-Ghassemi, O., Yuchi, Z., van Petegem, F. Mol Cell (2019).

Other PDB entries of the same protein (UniProt P05132 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RDQ 1.26 Å, Hydrolysis of ATP in the crystal of Y204A mutant of cAMP-dependent protein kinase
4DFX 1.35 Å, Crystal structure of myristoylated K7C catalytic subunit of cAMP-dependent protein…
4HPU 1.55 Å, Crystal structure of the catalytic subunit of cAMP-dependent protein kinase displaying…
4IAI 1.55 Å, X-ray Structure of cAMP dependent protein kinase A in complex with high Ca2+…
9PC1 1.55 Å, Co-crystal structure of the cAMP-dependent protein kinase catalytic subunit alpha with…
3FJQ 1.6 Å, Crystal structure of cAMP-dependent protein kinase catalytic subunit alpha in complex…
4IAK 1.6 Å, Low temperature X-ray structure of cAMP dependent protein kinase A in complex with high…
3IDB 1.62 Å, Crystal structure of (108-268)RIIb:C holoenzyme of cAMP-dependent protein kinase
4IB1 1.63 Å, Structure of cAMP dependent protein kinase A in complex with high K+ concentration, ADP…
7V0G 1.63 Å, Structure of cAMP-dependent protein kinase using a MD-MX procedure, produced using 1.63…
3QAL 1.7 Å, Crystal Structure of Arg280Ala mutant of Catalytic subunit of cAMP-dependent Protein…
3X2W 1.7 Å, Michaelis complex of cAMP-dependent Protein Kinase Catalytic Subunit

Browse structure collections

About this viewer

MolViewer shows 6MM7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.