Anti-HIV-1 Fab Fab 2G12 + Man4 re-refinement. Determined by X-ray diffraction at 2.0 Å resolution. Released 21 Nov 2018.
Explore 6MSY in 3D Show helices and sheets RCSB PDB PDBe
6MSY contains 15 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-7 | 5 | 6 |
| β-strand | 10-13 | 4 | 7 |
| β-strand | 18-25 | 8 | 6 |
| β-strand | 34-39 | 6 | 7 |
| β-strand | 45-51 | 7 | 7 |
| α-helix | 52A-54 | 3 | |
| β-strand | 57-59 | 3 | 7 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-72 | 6 | 6 |
| β-strand | 77-82 | 6 | 6 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 7 |
| β-strand | 100F-103 | 4 | 7 |
| β-strand | 107-112 | 6 | 7 |
| β-strand | 117 | 1 | 8 |
| α-helix | 118-119 | 2 | |
| β-strand | 120-124 | 5 | 9 |
| β-strand | 137-147 | 11 | 9 |
| β-strand | 148 | 1 | 8 |
| β-strand | 152-157 | 5 | 10 |
| α-helix | 162-164 | 3 | |
| β-strand | 166 | 1 | 10 |
| β-strand | 171-173 | 3 | 9 |
| α-helix | 174-176 | 3 | |
| β-strand | 177-178 | 2 | 9 |
| β-strand | 185-194 | 10 | 9 |
| β-strand | 206-212 | 7 | 10 |
| α-helix | 213-215 | 3 | |
| β-strand | 217-225 | 7 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-13 | 4 | 2 |
| β-strand | 18-25 | 8 | 1 |
| β-strand | 33-38 | 6 | 2 |
| β-strand | 45-49 | 5 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 55 | 1 | |
| β-strand | 62-67 | 6 | 1 |
| β-strand | 70-76 | 7 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 85-91 | 7 | 2 |
| β-strand | 96-98 | 3 | 2 |
| β-strand | 102-106 | 5 | 2 |
| β-strand | 111 | 1 | 3 |
| α-helix | 112-113 | 2 | |
| β-strand | 114-118 | 5 | 4 |
| α-helix | 119-121 | 3 | |
| α-helix | 122-126 | 5 | |
| β-strand | 129-139 | 11 | 4 |
| β-strand | 140 | 1 | 3 |
| β-strand | 144-150 | 7 | 5 |
| β-strand | 153-154 | 2 | 5 |
| α-helix | 155 | 1 | |
| β-strand | 159-163 | 5 | 4 |
| α-helix | 164-167 | 4 | |
| β-strand | 173-182 | 10 | 4 |
| α-helix | 183-187 | 5 | |
| β-strand | 192-198 | 7 | 5 |
| β-strand | 205-209 | 5 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fab 2G12, light chain | L | protein | 213 | Homo sapiens | P0DOX7 (AlphaFold model) |
| Fab 2g12, heavy chain | H | protein | 225 | Homo sapiens | P0DOX5 (AlphaFold model) |
>6MSY_1 Fab 2G12, light chain (chains L) DVVMTQSPSTLSASVGDTITITCRASQSIETWLAWYQQKPGKAPKLLIYKASTLKTGVPS RFSGSGSGTEFTLTISGLQFDDFATYHCQHYAGYSATFGQGTRVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
>6MSY_2 Fab 2g12, heavy chain (chains H) EVQLVESGGGLVKAGGSLILSCGVSNFRISAHTMNWVRRVPGGGLEWVASISTSSTYRDY ADAVKGRFTVSRDDLEDFVYLQMHKMRVEDTAIYYCARKGSDRLSDNDPFDAWGPGTVVT VSPASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Dissection of the carbohydrate specificity of the broadly neutralizing anti-HIV-1 antibody 2G12. Calarese, D.A., Lee, H.K., Huang, C.Y. et al. Proc Natl Acad Sci U S A (2005) 102:13372-13377. DOI 10.1073/pnas.0505763102 · PubMed
Other PDB entries of the same protein (UniProt P0DOX7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6MSY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.