6MUN: HRpn10

Structure of hRpn10 bound to UBQLN2 UBL. Determined by solution NMR. Released 4 Sept 2019.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 2,060
Mol. weight: 29.36 kDa
Released: 4 Sept 2019

Explore 6MUN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MUN contains 9 α-helices and 14 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	200-204	5
α-helix	210-212	3
α-helix	214-248	35
α-helix	255-271	17
α-helix	283-294	12

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	32-38	7	1
β-strand	43-49	7	1
β-strand	53	1	2
α-helix	54-65	12
β-strand	72-76	5	1
β-strand	79-81	3	1
β-strand	86	1	2
α-helix	87-90	4
β-strand	96-102	7	1

Chain C: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	32-38	7	3
β-strand	43-49	7	3
β-strand	53	1	4
α-helix	54-65	12
β-strand	72-76	5	3
β-strand	79-81	3	3
β-strand	86	1	4
α-helix	87-90	4
β-strand	97-102	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
26S proteasome non-ATPase regulatory subunit 4	A	protein	111	Homo sapiens	P55036 (AlphaFold model)
Ubiquilin-2	B, C	protein	78	Homo sapiens	Q9UHD9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6MUN_1 26S proteasome non-ATPase regulatory subunit 4 (chains A)
MLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAAASAAEAGIATTGTED
SDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEFGQAESA

Sequence of entity 2 (B, C), FASTA

>6MUN_2 Ubiquilin-2 (chains B, C)
APAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEAISKRFKSQTDQLVLIFAGKILKDQD
TLIQHGIHDGLTVHLVIK

Primary citation

Structure of hRpn10 Bound to UBQLN2 UBL Illustrates Basis for Complementarity between Shuttle Factors and Substrates at the Proteasome. Chen, X., Ebelle, D.L., Wright, B.J. et al. J Mol Biol (2019) 431:939-955. DOI 10.1016/j.jmb.2019.01.021 · PubMed

Other PDB entries of the same protein (UniProt P55036 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9K53 2.5 Å, Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state ED2.1
8USB 2.73 Å, Non-substrate-engaged human 26S proteasome with Nub1/FAT10 bound to Rpn1
9MBP 2.75 Å, Substrate-engaged human 26S proteasome bound to midnolin with RPT1 at top of spiral…
9NKG 2.8 Å, Structure of substrate engaged MIDN-bound human 26S proteasome, EB-MIDN (Composite map)
9E8I 2.87 Å, Human proteasome in resting state conformation bound to TXNL1 in Forward conformation
9BV3 2.9 Å, M1B Midnolin-Proteasome
9E8H 2.9 Å, Human proteasome in resting state conformation bound to TXNL1 in backward conformation
9K4J 2.9 Å, Structure of substrate-engaged human 26S proteasome RP-CP subcomplex in state EA1.0
9NKF 2.9 Å, Structure of human substrate-free 26S proteasome in the presence of ATPgS and…
9U3L 2.91 Å, Substrate-engaged human 26S proteasome bound to midnolin with RPT2 at top of spiral…
9NKI 2.94 Å, Structure of substrate engaged MIDN-bound human 26S proteasome, EB MIDN_UBL state…
6MSB 3.0 Å, Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome

Browse structure collections

About this viewer

MolViewer shows 6MUN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.