Crystal structure of Lecithin:cholesterol acyltransferase (LCAT) in complex with isopropyl dodec-11-enylfluorophosphonate (IDFP) and a small molecule activator. Determined by X-ray diffraction at 3.1 Å resolution. Released 5 Dec 2018.
Explore 6MVD in 3D Show helices and sheets RCSB PDB PDBe
6MVD contains 36 α-helices and 55 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-24 | 3 | |
| β-strand | 25-28 | 4 | 1 |
| β-strand | 36-40 | 5 | 2 |
| β-strand | 41 | 1 | 3 |
| β-strand | 53 | 1 | 3 |
| β-strand | 58-61 | 4 | 2 |
| α-helix | 64-66 | 3 | |
| α-helix | 71-79 | 9 | |
| β-strand | 81-84 | 4 | 4 |
| β-strand | 89-92 | 4 | 4 |
| β-strand | 96-99 | 4 | 2 |
| α-helix | 107-110 | 4 | |
| β-strand | 111 | 1 | 5 |
| β-strand | 119 | 1 | 5 |
| α-helix | 122-129 | 8 | |
| β-strand | 135 | 1 | 1 |
| β-strand | 139-141 | 3 | 1 |
| α-helix | 150-152 | 3 | |
| α-helix | 154-171 | 18 | |
| β-strand | 175-180 | 6 | 1 |
| α-helix | 182-192 | 11 | |
| α-helix | 196-202 | 7 | |
| β-strand | 203-209 | 7 | 1 |
| α-helix | 218-225 | 8 | |
| β-strand | 227 | 1 | 6 |
| β-strand | 232 | 1 | 6 |
| β-strand | 234 | 1 | 7 |
| α-helix | 242-244 | 3 | |
| β-strand | 246 | 1 | 7 |
| β-strand | 264-267 | 4 | 8 |
| β-strand | 272-274 | 3 | 8 |
| α-helix | 278-284 | 7 | |
| α-helix | 288-297 | 10 | |
| β-strand | 311-317 | 7 | 1 |
| β-strand | 319-326 | 8 | 8 |
| α-helix | 335-336 | 2 | |
| β-strand | 338-344 | 7 | 8 |
| β-strand | 349 | 1 | 8 |
| α-helix | 350-353 | 4 | |
| α-helix | 355-359 | 5 | |
| β-strand | 360 | 1 | 9 |
| β-strand | 363 | 1 | 9 |
| β-strand | 367-373 | 7 | 1 |
| α-helix | 377-379 | 3 | |
| α-helix | 384-394 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-28 | 4 | 10 |
| β-strand | 36-40 | 5 | 11 |
| β-strand | 41 | 1 | 12 |
| β-strand | 53 | 1 | 12 |
| β-strand | 58-61 | 4 | 11 |
| α-helix | 64-67 | 4 | |
| α-helix | 71-79 | 9 | |
| β-strand | 81 | 1 | 13 |
| β-strand | 82-84 | 3 | 14 |
| β-strand | 89-91 | 3 | 14 |
| α-helix | 92-93 | 2 | |
| β-strand | 96-99 | 4 | 11 |
| α-helix | 107-110 | 4 | |
| β-strand | 111 | 1 | 15 |
| β-strand | 119 | 1 | 15 |
| α-helix | 122-129 | 8 | |
| β-strand | 135 | 1 | 10 |
| β-strand | 139-141 | 3 | 10 |
| α-helix | 154-171 | 18 | |
| α-helix | 174 | 1 | |
| β-strand | 175-180 | 6 | 10 |
| α-helix | 182-193 | 12 | |
| α-helix | 196-202 | 7 | |
| β-strand | 203-209 | 7 | 10 |
| α-helix | 218-225 | 8 | |
| β-strand | 227-228 | 2 | 16 |
| β-strand | 231-232 | 2 | 16 |
| β-strand | 234 | 1 | 13 |
| β-strand | 246 | 1 | 13 |
| β-strand | 264-267 | 4 | 17 |
| β-strand | 272-274 | 3 | 17 |
| α-helix | 275-277 | 3 | |
| α-helix | 278-284 | 7 | |
| α-helix | 288-298 | 11 | |
| β-strand | 311-317 | 7 | 10 |
| β-strand | 319-327 | 9 | 17 |
| α-helix | 335 | 1 | |
| β-strand | 336-344 | 9 | 17 |
| β-strand | 349 | 1 | 17 |
| α-helix | 350-353 | 4 | |
| α-helix | 354-359 | 6 | |
| β-strand | 360 | 1 | 18 |
| β-strand | 363 | 1 | 18 |
| β-strand | 367-373 | 7 | 10 |
| α-helix | 379-381 | 3 | |
| α-helix | 384-394 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Phosphatidylcholine-sterol acyltransferase | A, B | protein | 383 | Homo sapiens | P04180 (AlphaFold model) |
>6MVD_1 Phosphatidylcholine-sterol acyltransferase (chains A, B) HTRPVILVPGCLGNQLEAKLDKPDVVNWMCYRKTEDFFTIWLDLNMFLPLGVDCWIDNTR VVYNRSSGLVSNAPGVQIRVPGFGKTYSVEYLDSSKLAGYLHTLVQNLVNNGYVRDETVR AAPYDWRLEPGQQEEYYRKLAGLVEEMHAAYGKPVFLIGHSLGCLHLLYFLLRQPQAWKD RFIDGFISLGAPWGGSIKPMLVLASGDNQGIPIMSSIKLKEEQRITTTSPWMFPSRMAWP EDHVFISTPSFNYTGRDFQRFFADLHFEEGWYMWLQSRDLLAGLPAPGVEVYCLYGVGLP TPRTYIYDHGFPYTDPVGVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNM VFSNLTLEHINAILLGAHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NI | Nickel (II) ion | Ni | 1 |
| H94 | 6-{4-[(4R)-4-hydroxy-6-oxo-4-(trifluoromethyl)-4,5,6,7-tetrahydro-2H-pyrazolo[3… | C19 H16 F6 N6 O2 | 2 |
| H9A | propan-2-yl hydrogen (R)-ethylphosphonate | C5 H13 O3 P | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 5 |
Water and common crystallization additives (SO4) are not listed.
Molecular basis for activation of lecithin:cholesterol acyltransferase by a compound that increases HDL cholesterol. Manthei, K.A., Yang, S.M., Baljinnyam, B. et al. Elife (2018) 7. DOI 10.7554/eLife.41604 · PubMed
Other PDB entries of the same protein (UniProt P04180 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6MVD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.