6MWC: PDB entry 6MWC

CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-5 antibody. Determined by electron microscopy at 7.5 Å resolution. Released 19 Dec 2018.

Method: Electron microscopy
Resolution: 7.5 Å
Organisms: Eastern equine encephalitis virus, Mus musculus
Chains: 16
Atoms: 35,528
Mol. weight: 567.63 kDa
Released: 19 Dec 2018

Explore 6MWC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MWC contains 104 α-helices and 486 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	1
β-strand	18-19	2	2
β-strand	24	1	3
β-strand	27-28	2	2
β-strand	31-32	2	4
β-strand	44-48	5	5
β-strand	51-52	2	6
α-helix	55-58	4
β-strand	59-61	3	7
β-strand	77-82	6	7
β-strand	87	1	8
β-strand	101-106	6	7
β-strand	109-110	2	6
α-helix	113-115	3
β-strand	119-123	5	5
β-strand	131	1	9
β-strand	134-135	2	4
β-strand	144	1	4
β-strand	147	1	9
β-strand	161-163	3	1
β-strand	177-181	5	5
β-strand	184-186	3	5
α-helix	196-197	2
β-strand	204-206	3	5
β-strand	214-216	3	5
β-strand	221-222	2	10
α-helix	224-225	2
β-strand	229	1	8
β-strand	234-235	2	10
α-helix	237-239	3
α-helix	252-255	4
β-strand	261-262	2	11
β-strand	269-270	2	11
β-strand	276-282	7	1
α-helix	285-287	3
α-helix	288-289	2
β-strand	290	1	3
α-helix	291-293	3
α-helix	295-296	2
β-strand	301-306	6	12
β-strand	307-308	2	13
β-strand	315-320	6	12
β-strand	327-330	4	14
β-strand	339-340	2	12
β-strand	344-347	4	14
β-strand	352	1	12
β-strand	355-358	4	12
β-strand	367	1	15
β-strand	376	1	15
β-strand	381-382	2	13
β-strand	389	1	16

Chain B: 4 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	509	1	17
β-strand	512	1	17
β-strand	520-524	5	18
β-strand	531-540	10	18
β-strand	541	1	19
β-strand	551-556	6	19
β-strand	559-564	6	19
β-strand	569-571	3	20
β-strand	575	1	20
β-strand	577-589	13	18
β-strand	593-599	7	20
β-strand	608-615	8	20
α-helix	618-619	2
β-strand	623	1	21
β-strand	634-636	3	22
β-strand	639-640	2	23
β-strand	650-652	3	24
β-strand	660	1	25
β-strand	666-667	2	26
β-strand	672-673	2	26
β-strand	681	1	27
β-strand	686	1	28
α-helix	707-709	3
β-strand	710	1	28
β-strand	713	1	25
β-strand	715	1	27
β-strand	738-740	3	24
β-strand	745-746	2	23
β-strand	749-751	3	22
α-helix	755-758	4
β-strand	759-763	5	29
β-strand	766-771	6	29
β-strand	777-781	5	21
β-strand	791-795	5	21
β-strand	799-801	3	29
β-strand	804	1	29
β-strand	810-812	3	21
α-helix	818-819	2
β-strand	820-822	3	21
β-strand	823	1	16

Chain C: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	30
α-helix	7-9	3
β-strand	10-12	3	31
β-strand	18-25	8	30
α-helix	29-31	3
β-strand	34-40	7	31
β-strand	44-51	8	31
β-strand	58-60	3	31
α-helix	62-64	3
β-strand	65	1	30
β-strand	68-73	6	30
α-helix	74-76	3
β-strand	78-83	6	30
α-helix	88-90	3
β-strand	92-100	9	31
β-strand	103-107	5	31
β-strand	111-115	5	31
β-strand	121	1	32
β-strand	124-128	5	33
β-strand	139-149	11	33
β-strand	150	1	32
β-strand	155-158	4	34
α-helix	159-161	3
β-strand	167-175	9	33
β-strand	178-188	11	33
β-strand	198-203	6	34
α-helix	204-206	3
β-strand	208-213	6	34

Chain D: 5 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	504-506	3	35
β-strand	509-512	4	31
β-strand	517-524	8	35
α-helix	531-533	3
β-strand	536-541	6	31
β-strand	545-551	7	31
β-strand	555-556	2	31
α-helix	557	1
β-strand	564-569	6	35
β-strand	572-578	7	35
α-helix	582-584	3
β-strand	586-593	8	31
β-strand	598-600	3	31
β-strand	604-608	5	31
β-strand	614	1	36
β-strand	617-621	5	37
α-helix	622-624	3
β-strand	632-642	11	37
β-strand	643	1	36
β-strand	647-651	5	38
β-strand	652-653	2	39
β-strand	656-657	2	39
β-strand	662-664	3	37
β-strand	668-669	2	37
β-strand	675-684	10	37
α-helix	685-690	6
β-strand	693-700	8	38
β-strand	703-710	8	38

Chain E: 10 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	1003-1008	6	40
β-strand	1018-1019	2	41
β-strand	1024	1	42
β-strand	1027-1028	2	41
β-strand	1031-1032	2	43
β-strand	1044-1048	5	44
β-strand	1051-1052	2	45
α-helix	1055-1058	4
β-strand	1059-1061	3	46
β-strand	1077-1082	6	46
β-strand	1087	1	47
β-strand	1101-1106	6	46
β-strand	1109-1110	2	45
α-helix	1113-1115	3
β-strand	1119-1123	5	44
β-strand	1131	1	48
β-strand	1134-1135	2	43
β-strand	1144	1	43
β-strand	1147	1	48
β-strand	1161-1163	3	40
β-strand	1177-1181	5	44
β-strand	1184-1186	3	44
α-helix	1196-1197	2
β-strand	1204-1206	3	44
β-strand	1214-1216	3	44
β-strand	1221-1222	2	49
α-helix	1224-1225	2
β-strand	1229	1	47
β-strand	1234-1235	2	49
α-helix	1237-1239	3
α-helix	1252-1255	4
β-strand	1261-1262	2	50
β-strand	1269-1270	2	50
β-strand	1276-1282	7	40
α-helix	1285-1287	3
α-helix	1288-1289	2
β-strand	1290	1	42
α-helix	1291-1293	3
α-helix	1295-1296	2
β-strand	1301-1306	6	51
β-strand	1307-1308	2	52
β-strand	1315-1320	6	51
β-strand	1327-1330	4	53
β-strand	1339-1340	2	51
β-strand	1344-1347	4	53
β-strand	1352	1	51
β-strand	1355-1358	4	51
β-strand	1367	1	54
β-strand	1376	1	54
β-strand	1381-1382	2	52
β-strand	1389	1	55

Chain F: 4 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	1509	1	56
β-strand	1512	1	56
β-strand	1520-1524	5	57
β-strand	1531-1540	10	57
β-strand	1541	1	58
β-strand	1551-1556	6	58
β-strand	1559-1564	6	58
β-strand	1569-1571	3	59
β-strand	1575	1	59
β-strand	1577-1589	13	57
β-strand	1593-1599	7	59
β-strand	1608-1615	8	59
α-helix	1618-1619	2
β-strand	1623	1	60
β-strand	1634-1636	3	61
β-strand	1639-1640	2	62
β-strand	1650-1652	3	63
β-strand	1660	1	64
β-strand	1666-1667	2	65
β-strand	1672-1673	2	65
β-strand	1678	1	66
β-strand	1681	1	67
β-strand	1686	1	68
α-helix	1707-1709	3
β-strand	1710	1	68
β-strand	1713	1	64
β-strand	1715	1	67
β-strand	1738-1740	3	63
β-strand	1745-1746	2	62
β-strand	1749-1751	3	61
α-helix	1755-1758	4
β-strand	1759-1763	5	69
β-strand	1766-1771	6	69
β-strand	1777-1781	5	60
β-strand	1791-1795	5	60
β-strand	1799-1801	3	69
β-strand	1804	1	69
β-strand	1810-1812	3	60
α-helix	1818-1819	2
β-strand	1820-1822	3	60
β-strand	1823	1	55

Chain G: 7 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3003-3006	4	70
α-helix	3007-3009	3
β-strand	3010-3012	3	71
β-strand	3018-3025	8	70
α-helix	3029-3031	3
β-strand	3034-3040	7	71
β-strand	3044-3051	8	71
β-strand	3058-3060	3	71
α-helix	3062-3064	3
β-strand	3065	1	70
β-strand	3068-3073	6	70
α-helix	3074-3076	3
β-strand	3078-3083	6	70
α-helix	3088-3090	3
β-strand	3092-3100	9	71
β-strand	3103-3107	5	71
β-strand	3111-3115	5	71
β-strand	3121	1	72
β-strand	3124-3128	5	73
β-strand	3139-3149	11	73
β-strand	3150	1	72
β-strand	3155-3158	4	74
α-helix	3159-3161	3
β-strand	3167-3175	9	73
β-strand	3178-3188	11	73
β-strand	3198-3203	6	74
α-helix	3204-3206	3
β-strand	3208-3213	6	74

Chain H: 5 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	3504-3506	3	75
β-strand	3509-3512	4	71
β-strand	3517-3524	8	75
α-helix	3531-3533	3
β-strand	3536-3541	6	71
β-strand	3545-3551	7	71
β-strand	3555-3556	2	71
α-helix	3557	1
β-strand	3564-3569	6	75
β-strand	3572-3578	7	75
α-helix	3582-3584	3
β-strand	3586-3593	8	71
β-strand	3595	1	66
β-strand	3598-3600	3	71
β-strand	3604-3608	5	71
β-strand	3614	1	76
β-strand	3617-3621	5	77
α-helix	3622-3624	3
β-strand	3632-3642	11	77
β-strand	3643	1	76
β-strand	3647-3651	5	78
β-strand	3652-3653	2	79
β-strand	3656-3657	2	79
β-strand	3662-3664	3	77
β-strand	3668-3669	2	77
β-strand	3675-3684	10	77
α-helix	3685-3690	6
β-strand	3693-3700	8	78
β-strand	3703-3710	8	78

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E1	A, E, I, M	protein	441	Eastern equine encephalitis virus	Q4QXJ7
E2	B, F, J, N	protein	420	Eastern equine encephalitis virus	Q4QXJ7
EEEV-5 antibody heavy chain	C, G, K, O	protein	218	Mus musculus
EEEV-5 antibody light chain	D, H, L, P	protein	214	Mus musculus	G0YP42 (AlphaFold model)

Sequence of entity 1 (A, E, I, M), FASTA

>6MWC_1 E1 (chains A, E, I, M)
YEHTAVMPNKVGIPYKALVERPGYAPVHLQIQLVNTRIIPSTNLEYITCKYKTKVPSPVV
KCCGATQCTSKPHPDYQCQVFTGVYPFMWGGAYCFCDTENTQMSEAYVERSEECSIDHAK
AYKVHTGTVQAMVNITYGSVSWRSADVYVNGETPAKIGDAKLIIGPLSSAWSPFDNKVVV
YGHEVYNYDFPEYGTGKAGSFGDLQSRTSTSNDLYANTNLKLQRPQAGIVHTPFTQAPSG
FERWKRDKGAPLNDVAPFGCSIALEPLRAENCAVGSIPISIDIPDAAFTRISETPTVSDL
ECKITECTYASDFGGIATVAYKSSKAGNCPIHSPSGVAVIKENDVTLAESGSFTFHFSTA
NIHPAFKLQVCTSAVTCKGDCKPPKDHIVDYPAQHTESFTSAISATAWSWLKVLVGGTSA
FIVLGLIATAVVALVLFFHRH

Sequence of entity 2 (B, F, J, N), FASTA

>6MWC_2 E2 (chains B, F, J, N)
DLDTHFTQYKLARPYIADCPNCGHSRCDSPIAIEEVRGDAHAGVIRIQTSAMFGLKTDGV
DLAYMSFMNGKTQKSIKIDNLHVRTSAPCSLVSHHGYYILAQCPPGDTVTVGFHDGPNRH
TCTVAHKVEFRPVGREKYRHPPEHGVELPCNRYTHKRADQGHYVEMHQPGLVADHSLLSI
HSAKVKITVPSGAQVKYYCKCPDVREGITSSDHTTTCTDVKQCRAYLIDNKKWVYNSGRL
PRGEGDTFKGKLHVPFVPVKAKCIATLAPEPLVEHKHRTLILHLHPDHPTLLTTRSLGSD
ANPTRQWIERPTTVNFTVTGEGLEYTWGNHPPKRVWAQESGEGNPHGWPHEVVVYYYNRY
PLTTIIGLCTCVAIIMVSCVTSVWLLCRTRNLCITPYKLAPNAQVPILLALLCCIKPTRA

Sequence of entity 3 (C, G, K, O), FASTA

>6MWC_3 EEEV-5 antibody heavy chain (chains C, G, K, O)
QIQLVQSGREVKNPGETVKISCKASGYTFTEYPMLWVKQAPGKGFRWMGLIYTNTGEPTY
AEEFKGRFVFSLEISASTAYLQINNLTNEDTATYFCVRDYFISLDYWGQGTTLTVSSAKT
TAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYT
LSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIESRR

Sequence of entity 4 (D, H, L, P), FASTA

>6MWC_4 EEEV-5 antibody light chain (chains D, H, L, P)
QAVVTQESALTTSPGETVTLTCRSNIGAVTSSNCANWVQEKPDHFFTGLIGDTNNRRSGV
PARFSGSLIGDKAALTITGAQTEDEAIYFCALWYNNLWVFGGGTKLTVLGQPKSSPSVTL
FPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKYMASSY
LTLTARAWERHSSYSCQVTHEGHTVEKSLSRADC

Primary citation

Cryo-EM Structures of Eastern Equine Encephalitis Virus Reveal Mechanisms of Virus Disassembly and Antibody Neutralization. Hasan, S.S., Sun, C., Kim, A.S. et al. Cell Rep (2018) 25:3136-3147.e5. DOI 10.1016/j.celrep.2018.11.067 · PubMed

Other PDB entries of the same protein (UniProt Q4QXJ7), best resolution first:

8XI4 3.4 Å, Structure of Eastern Equine Encephalitis VLP in complex with the receptor VLDLR LA1-2
8XI5 3.4 Å, Structure of Eastern Equine Encephalitis VLP in complex with the receptor VLDLR LA3-5
6XO4 4.2 Å, CryoEM structure of Eastern Equine Encephalitis (EEEV) VLP
6MX4 4.4 Å, CryoEM structure of chimeric Eastern Equine Encephalitis Virus
8YS4 4.8 Å, Overall structure of Eastern Equine Encephalitis virus VLP in complex with the receptor…
7V0P 5.2 Å, Cryo-EM structure of SINV/EEEV in complex with Fab fragment of a potently neutralizing…
8YS2 5.2 Å, Overall structure of Eastern Equine Encephalitis virus VLP in complex with the receptor…
6ODF 5.8 Å, EEEV glycoproteins bound with heparan sulfate
7V0N 5.9 Å, Cryo-EM structure of SINV/EEEV in complex with Fab fragment of a moderately/weakly…
7V0O 6.6 Å, Cryo-EM structure of SINV/EEEV in complex with Fab fragment of a moderately/weakly…
6MW9 7.3 Å, CryoEM structure of chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-3 antibody
6MWV 7.3 Å, CryoEM structure of Chimeric Eastern Equine Encephalitis Virus with Fab of EEEV-58…

Browse structure collections

About this viewer

MolViewer shows 6MWC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.