6MWD: Ion transport protein

NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206S. Determined by X-ray diffraction at 2.33 Å resolution. Released 19 Dec 2018.

Method: X-ray diffraction
Resolution: 2.33 Å
Organism: Arcobacter butzleri (strain RM4018)
Chains: 1
Atoms: 2,116
Mol. weight: 34.49 kDa
Ligands: CPS, PX4
Released: 19 Dec 2018

Explore 6MWD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MWD contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	2000-2010	11
α-helix	2012-2031	20
α-helix	2035-2067	33
α-helix	2069-2072	4
α-helix	2075-2086	12
α-helix	2097-2101	5
α-helix	2102-2107	6
α-helix	2108-2112	5
α-helix	2114-2125	12
α-helix	2128-2130	3
α-helix	2131-2152	22
α-helix	2157-2160	4
α-helix	2163-2174	12
α-helix	2179-2184	6
α-helix	2185-2190	6
α-helix	2194-2237	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ion transport protein	B	protein	257	Arcobacter butzleri (strain RM4018)	A8EVM5 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>6MWD_1 Ion transport protein (chains B)
MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFG
VYTTLFNQIVITIFTIEIILRIYVHRISFFKDPWSLFDFFVVAISLVPTSSGFEILRVLR
VLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPEWFGT
LGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVSFVMINLVVAIIVDAMA
ILNQKEEQHIIDEVQSH

Ligands and cofactors

ID	Name	Formula	Copies
CPS	3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate	C32 H58 N2 O7 S	3
PX4	1,2-dimyristoyl-sn-glycero-3-phosphocholine	C36 H73 N O8 P	4

Water and common crystallization additives (ACT, SO4) are not listed.

Primary citation

Molecular dissection of multiphase inactivation of the bacterial sodium channel NaVAb. Gamal El-Din, T.M., Lenaeus, M.J., Ramanadane, K. et al. J Gen Physiol (2019) 151:174-185. DOI 10.1085/jgp.201711884 · PubMed

Other PDB entries of the same protein (UniProt A8EVM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MWA 2.4 Å, NavAb Voltage-gated Sodium Channel, residues 1-239
9UC1 2.5 Å, Crystal structure of voltage-gated sodium channel NavAb N49K/S178T mutant
6MWG 2.5 Å, NavAb Voltage-gated Sodium Channel, residues 1-239, with mutation T206V
6C1M 2.52 Å, NavAb NormoPP mutant
8DIV 2.54 Å, Crystal structure of NavAb I22V as a basis for the human Nav1.7 Inherited…
6MWB 2.6 Å, NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206A
8VGL 2.6 Å, CryoEM structure of Nav1.7 in complex with wild type Fab 7A9
8VGM 2.6 Å, CryoEM structure of Nav1.7 in complex with engineered conformationally rigid Fab 7A9.4DS
3RVY 2.7 Å, Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.7 A)
5KLB 2.7 Å, Crystal structure of the CavAb voltage-gated calcium channel(wild-type, 2.7A)
6C1K 2.7 Å, HypoPP mutant with ligand1
8DJ0 2.7 Å, Crystal structure of NavAb L123T as a basis for the human Nav1.7 Inherited…

Browse structure collections

About this viewer

MolViewer shows 6MWD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.