6MXY: 53BP1 tandem Tudor domains

Structure of 53BP1 tandem Tudor domains in complex with small molecule UNC3351. Determined by X-ray diffraction at 1.62 Å resolution. Released 27 Nov 2019.

Method: X-ray diffraction
Resolution: 1.62 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,398
Mol. weight: 28.67 kDa
Ligands: PO4, K6M
Released: 27 Nov 2019

Explore 6MXY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MXY contains 11 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	1482-1484	3
β-strand	1490-1494	5	1
β-strand	1501-1511	11	1
β-strand	1514-1519	6	1
β-strand	1524-1528	5	1
α-helix	1529-1531	3
β-strand	1532-1533	2	1
α-helix	1538-1539	2
β-strand	1543-1546	4	2
β-strand	1548	1	3
β-strand	1551	1	3
β-strand	1555-1563	9	2
β-strand	1568-1574	7	2
β-strand	1577-1582	6	2
α-helix	1583-1585	3
β-strand	1586-1587	2	2
β-strand	1588	1	1
α-helix	1590-1600	11
β-strand	1601	1	1

Chain B: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	1490-1493	4	4
α-helix	1499-1500	2
β-strand	1501	1	5
β-strand	1502-1511	10	4
β-strand	1514-1519	6	4
β-strand	1524-1528	5	4
α-helix	1529-1531	3
β-strand	1532-1533	2	4
α-helix	1538-1539	2
β-strand	1543-1546	4	6
β-strand	1548	1	7
β-strand	1551	1	7
β-strand	1555-1564	10	6
β-strand	1567-1574	8	6
β-strand	1577-1582	6	6
α-helix	1583-1585	3
β-strand	1586-1587	2	6
β-strand	1588	1	5
α-helix	1590-1594	5
α-helix	1597-1600	4
β-strand	1601	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
TP53-binding protein 1	A, B	protein	123	Homo sapiens	Q12888 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6MXY_1 TP53-binding protein 1 (chains A, B)
GHMNSFVGLRVVAKWSSNGYFYSGKITRDVGAGKYKLLFDDGYECDVLGKDILLCDPIPL
DTEVTALSEDEYFSAGVVKGHRKESGELYYSIEKEGQRKWYKRMAVILSLEQGNRLREQY
GLG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	5
K6M	N-[3-(tert-butylamino)propyl]-3-(trifluoromethyl)benzamide	C15 H21 F3 N2 O	1

Primary citation

An autoinhibited state of 53BP1 revealed by small molecule antagonists and protein engineering. Cui, G., Botuyan, M.V., Drane, P. et al. Nat Commun (2023) 14:6091-6091. DOI 10.1038/s41467-023-41821-6 · PubMed

Other PDB entries of the same protein (UniProt Q12888 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SVI 1.15 Å, Ubiquitin variant i53:Mutant L67H with 53BP1 Tudor domain
8SVH 1.16 Å, Ubiquitin variant i53 mutant L67R bound to 53BP1 Tudor Domain
8SVG 1.21 Å, Ubiquitin variant i53 in complex with 53BP1 Tudor domain
2G3R 1.25 Å, Crystal Structure of 53BP1 tandem tudor domains at 1.2 A resolution
6VA5 1.28 Å, Tudor Domain of Tumor suppressor p53BP1 with MFP-4184
6VIP 1.36 Å, Tudor domain of tumor suppressor P53BP1 with mfp-6008
7LIN 1.44 Å, X-ray structure of SPOP MATH domain (D140G) in complex with a 53BP1 peptide
3LGF 1.5 Å, Crystal structure of the 53BP1 tandem tudor domain in complex with p53K370me2
4RG2 1.5 Å, Tudor Domain of Tumor suppressor p53BP1 with small molecule ligand
8SVJ 1.5 Å, Ubiquitin variant i53: mutant VHH with 53BP1 Tudor domain
8F0W 1.52 Å, Tudor Domain of Tumor suppressor p53BP1 with MFP-5956
3LGL 1.6 Å, Crystal structure of the 53BP1 tandem tudor domain in complex with p53K382me2

Browse structure collections

About this viewer

MolViewer shows 6MXY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.