Zebrafish betaglycan orphan domain structure from tetragonal crystal form. Determined by X-ray diffraction at 2.38 Å resolution. Released 21 Aug 2019.
Explore 6MZN in 3D Show helices and sheets RCSB PDB PDBe
6MZN contains 5 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 34-35 | 2 | 1 |
| β-strand | 42-49 | 8 | 2 |
| β-strand | 51-56 | 6 | 3 |
| α-helix | 59-62 | 4 | |
| β-strand | 66-72 | 7 | 3 |
| β-strand | 85-93 | 9 | 2 |
| β-strand | 100 | 1 | 4 |
| β-strand | 104-109 | 6 | 3 |
| β-strand | 114-120 | 7 | 2 |
| β-strand | 123 | 1 | 4 |
| β-strand | 129-133 | 5 | 3 |
| β-strand | 138-140 | 3 | 2 |
| β-strand | 153-154 | 2 | 3 |
| α-helix | 161-171 | 11 | |
| β-strand | 177-181 | 5 | 3 |
| β-strand | 186-191 | 6 | 2 |
| β-strand | 204 | 1 | 3 |
| β-strand | 209 | 1 | 2 |
| β-strand | 212-220 | 9 | 2 |
| β-strand | 223-226 | 4 | 1 |
| β-strand | 234-243 | 10 | 1 |
| β-strand | 253-260 | 8 | 2 |
| β-strand | 267-268 | 2 | 5 |
| β-strand | 270-277 | 8 | 1 |
| β-strand | 282-287 | 6 | 2 |
| β-strand | 290-291 | 2 | 5 |
| β-strand | 292-297 | 6 | 1 |
| β-strand | 301-304 | 4 | 2 |
| α-helix | 306-311 | 6 | |
| β-strand | 312-314 | 3 | 1 |
| α-helix | 315-316 | 2 | |
| α-helix | 326-335 | 10 | |
| β-strand | 343-349 | 7 | 1 |
| β-strand | 352-357 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transforming growth factor beta receptor III | A | protein | 338 | Danio rerio | E7FDB6 (AlphaFold model) |
>6MZN_1 Transforming growth factor beta receptor III (chains A) GSPCELLPVGVGHPVQAMLKSFTALSGCASRGTTSHPQEVHIINLRKGSAQGAREKTAEV ALHLRPIQSLHVHQKPLVFILNSPQPILWKVRTEKLAPGVKRIFHVVEGSEVHFEVGNFS KSCEVKVETLPHGNEHLLNWAHHRYTAVTSFSELRMAHDIYIKVGEDPVFSETCKIDNKF LSLNYLASYIEPQPSTGCVLSGPDHEQEVHIIELQAPNSSSAFQVDVIVDLRPLDGDIPL HRDVVLLLKCEKSVNWVIKAHKVMGKLEIMTSDTVSLSEDTERLMQVSKTVKQKLPAGSQ ALIQWAEENGFNPVTSYTNTPVANHFNLRLREHHHHHH
Structural Adaptation in Its Orphan Domain Engenders Betaglycan with an Alternate Mode of Growth Factor Binding Relative to Endoglin. Kim, S.K., Whitley, M.J., Krzysiak, T.C. et al. Structure (2019) 27:1427-1442.e4. DOI 10.1016/j.str.2019.06.010 · PubMed
Other PDB entries of the same protein (UniProt E7FDB6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6MZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.