6MZP: Transforming growth factor beta receptor III

Zebrafish betaglycan orphan domain structure from orthorhombic crystal form. Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Aug 2019.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Danio rerio
Chains: 2
Atoms: 4,881
Mol. weight: 75.64 kDa
Released: 21 Aug 2019

Explore 6MZP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6MZP contains 7 α-helices and 55 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	1
β-strand	42-49	8	2
β-strand	51-56	6	3
β-strand	66-72	7	3
β-strand	85-93	9	2
β-strand	100	1	4
β-strand	104-109	6	3
β-strand	114-120	7	2
β-strand	123	1	4
β-strand	129-133	5	3
β-strand	138-141	4	2
β-strand	150-154	5	3
α-helix	161-171	11
β-strand	177-181	5	3
β-strand	186-191	6	2
β-strand	204	1	3
β-strand	212-220	9	2
β-strand	223-226	4	1
β-strand	234-243	10	1
β-strand	252-260	9	2
β-strand	267-268	2	5
β-strand	270-277	8	1
β-strand	281-287	7	2
β-strand	290-291	2	5
β-strand	293-297	5	1
β-strand	301-304	4	2
α-helix	306-311	6
β-strand	313-314	2	1
α-helix	326-335	10
β-strand	343-349	7	1
β-strand	352-357	6	2

Chain B: 4 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	34-35	2	6
β-strand	42-49	8	7
β-strand	51-56	6	8
β-strand	67-72	6	8
β-strand	85-93	9	7
α-helix	103-104	2
β-strand	105-109	5	8
β-strand	114-119	6	7
β-strand	130-133	4	8
β-strand	138-139	2	7
β-strand	151-154	4	8
α-helix	161-169	9
β-strand	177-181	5	8
β-strand	186-191	6	7
β-strand	204	1	8
β-strand	209	1	7
β-strand	212-220	9	7
β-strand	223-226	4	6
β-strand	235-243	9	6
β-strand	252-259	8	7
β-strand	267-268	2	9
β-strand	271-277	7	6
β-strand	281-287	7	7
β-strand	290-291	2	9
β-strand	292-297	6	6
β-strand	301-304	4	7
α-helix	306-311	6
β-strand	312-314	3	6
α-helix	326-335	10
β-strand	343-349	7	6
β-strand	352-356	5	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transforming growth factor beta receptor III	A, B	protein	338	Danio rerio	E7FDB6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6MZP_1 Transforming growth factor beta receptor III (chains A, B)
GSPCELLPVGVGHPVQAMLKSFTALSGCASRGTTSHPQEVHIINLRKGSAQGAREKTAEV
ALHLRPIQSLHVHQKPLVFILNSPQPILWKVRTEKLAPGVKRIFHVVEGSEVHFEVGNFS
KSCEVKVETLPHGNEHLLNWAHHRYTAVTSFSELRMAHDIYIKVGEDPVFSETCKIDNKF
LSLNYLASYIEPQPSTGCVLSGPDHEQEVHIIELQAPNSSSAFQVDVIVDLRPLDGDIPL
HRDVVLLLKCEKSVNWVIKAHKVMGKLEIMTSDTVSLSEDTERLMQVSKTVKQKLPAGSQ
ALIQWAEENGFNPVTSYTNTPVANHFNLRLREHHHHHH

Primary citation

Structural Adaptation in Its Orphan Domain Engenders Betaglycan with an Alternate Mode of Growth Factor Binding Relative to Endoglin. Kim, S.K., Whitley, M.J., Krzysiak, T.C. et al. Structure (2019) 27:1427-1442.e4. DOI 10.1016/j.str.2019.06.010 · PubMed

Other PDB entries of the same protein (UniProt E7FDB6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MZN 2.38 Å, Zebrafish betaglycan orphan domain structure from tetragonal crystal form
9B9F 3.0 Å, Zebrafish Betaglycan Orphan Domain (zfBGo) in complex with TGF-B3 and extracellular…
9FKP 3.72 Å, Zebrafish Betaglycan Orphan Domain (zfBGo) in complex with TGF-b1 and extracellular…
9FK5 4.1 Å, Zebrafish Betaglycan Orphan Domain (zfBGo) in complex with TGF-B3 and extracellular…

Browse structure collections

About this viewer

MolViewer shows 6MZP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.