6N5Z: SNX5 PX domain

Crystal structure of the SNX5 PX domain in complex with the Sema4C. Determined by X-ray diffraction at 2.45 Å resolution. Released 18 Sept 2019.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,656
Mol. weight: 40.65 kDa
Released: 18 Sept 2019

Explore 6N5Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6N5Z contains 16 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	31-41	11	1
β-strand	44-53	10	1
β-strand	62-67	6	1
α-helix	69-80	12
α-helix	83-85	3
α-helix	91-97	7
α-helix	100-110	11
α-helix	113-115	3
α-helix	118-152	35
α-helix	156-158	3
α-helix	160-167	8
β-strand	178-182	5	2
β-strand	185-188	4	2

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	31-34	4	2
β-strand	37-41	5	2
β-strand	44-53	10	2
β-strand	62-68	7	2
α-helix	69-80	12
α-helix	83-85	3
α-helix	91-97	7
α-helix	100-111	12
α-helix	113-115	3
α-helix	118-152	35
α-helix	156-158	3
α-helix	160-167	8
β-strand	178-182	5	1
β-strand	185-189	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sorting nexin-5,Semaphorin-4C	A, B	protein	179	Homo sapiens	Q9C0C4 (AlphaFold model), Q9Y5X3 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6N5Z_1 Sorting nexin-5,Semaphorin-4C (chains A, B)
GSSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHEDFVWLHDTL
IETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKT
VSSHEVFLQRLSSHPVLSKDRNFHVFLEYDQPANWDPVGYYYSDGSLKIVPGHARCQPG

Primary citation

Molecular identification of a BAR domain-containing coat complex for endosomal recycling of transmembrane proteins. Simonetti, B., Paul, B., Chaudhari, K. et al. Nat Cell Biol (2019) 21:1219-1233. DOI 10.1038/s41556-019-0393-3 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6N5Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.