6NO7: Full-length wild-type PKA RIa Holoenzyme

Crystal Structure of the full-length wild-type PKA RIa Holoenzyme. Determined by X-ray diffraction at 3.55 Å resolution. Released 24 Jul 2019.

Method: X-ray diffraction
Resolution: 3.55 Å
Organisms: Homo sapiens, Bos taurus
Chains: 8
Atoms: 20,128
Mol. weight: 335.93 kDa
Ligands: MG, ATP
Released: 24 Jul 2019

Explore 6NO7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6NO7 contains 124 α-helices and 134 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	40-42	3
β-strand	43-51	9	1
β-strand	56-62	7	1
β-strand	68-75	8	1
α-helix	76-81	6
α-helix	85-95	11
β-strand	103	1	2
α-helix	104-105	2
β-strand	106-111	6	1
β-strand	115-121	7	1
α-helix	122	1
β-strand	127	1	2
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	3
α-helix	169-171	3
β-strand	172-174	3	2
β-strand	180-182	3	2
β-strand	189-190	2	3
β-strand	195	1	4
β-strand	199-200	2	5
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	4
α-helix	219-233	15
α-helix	243-252	10
α-helix	263-272	10
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-306	5

Chain B: 14 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	94-97	4
β-strand	98-99	2	5
α-helix	105-110	6
β-strand	113-115	3	6
α-helix	120-129	10
α-helix	134-137	4
α-helix	141-150	10
β-strand	152-156	5	7
β-strand	161-163	3	8
β-strand	168	1	9
α-helix	169	1
β-strand	171-177	7	7
β-strand	180-184	5	8
β-strand	187-192	6	8
β-strand	197-198	2	7
α-helix	200-203	4
β-strand	208	1	9
β-strand	212-215	4	8
β-strand	219-225	7	7
α-helix	226-249	24
α-helix	252-254	3
α-helix	259-268	10
β-strand	270-274	5	10
β-strand	279-281	3	10
β-strand	286-287	2	11
β-strand	289-303	15	10
β-strand	310-316	7	10
β-strand	321-322	2	10
α-helix	325-327	3
β-strand	331-332	2	11
β-strand	336-349	14	10
α-helix	350-357	8
α-helix	360-364	5
α-helix	368-373	6

Chain C: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	40-42	3
β-strand	43-51	9	12
β-strand	56-62	7	12
β-strand	68-75	8	12
α-helix	76-81	6
α-helix	85-95	11
β-strand	103	1	13
α-helix	104-105	2
β-strand	106-111	6	12
β-strand	115-121	7	12
α-helix	122	1
β-strand	127	1	13
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	14
α-helix	169-171	3
β-strand	172-174	3	13
β-strand	180-182	3	13
β-strand	189-190	2	14
β-strand	195	1	15
β-strand	199-200	2	16
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	15
α-helix	218-233	16
α-helix	243-252	10
α-helix	263-272	10
α-helix	289-292	4
α-helix	295-297	3
α-helix	302-306	5

Chain D: 13 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	94-97	4
β-strand	98-99	2	16
α-helix	105-110	6
α-helix	120-130	11
α-helix	141-150	10
β-strand	152-156	5	17
β-strand	161-163	3	18
β-strand	165	1	19
β-strand	168	1	20
α-helix	169	1
β-strand	171-177	7	17
β-strand	180-184	5	18
β-strand	187-192	6	18
β-strand	197-198	2	17
α-helix	200-203	4
β-strand	208	1	20
β-strand	209	1	19
β-strand	212-215	4	18
β-strand	219-225	7	17
α-helix	226-249	24
α-helix	252-254	3
α-helix	259-268	10
β-strand	270-274	5	21
β-strand	279-281	3	21
β-strand	286-287	2	22
β-strand	289-303	15	21
β-strand	310-316	7	21
β-strand	321-322	2	21
α-helix	325-327	3
β-strand	331-332	2	22
β-strand	336-349	14	21
α-helix	350-357	8
α-helix	360-364	5
α-helix	368-373	6

Chain E: 18 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	16-31	16
α-helix	40-42	3
β-strand	43-51	9	23
β-strand	56-62	7	23
β-strand	68-75	8	23
α-helix	76-81	6
α-helix	85-96	12
α-helix	104-105	2
β-strand	106-111	6	23
β-strand	115-120	6	23
β-strand	127	1	24
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	25
α-helix	169-171	3
β-strand	172-174	3	24
β-strand	180-182	3	24
β-strand	189-190	2	25
β-strand	195	1	26
β-strand	199-200	2	27
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	26
α-helix	218-233	16
α-helix	243-252	10
α-helix	263-272	10
α-helix	289-292	4
α-helix	295-297	3
α-helix	303-306	4
α-helix	311-312	2
α-helix	344-347	4

Chain F: 13 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	95-97	3
β-strand	98-99	2	27
α-helix	106-108	3
β-strand	112-114	3	6
α-helix	120-130	11
α-helix	134-137	4
α-helix	141-150	10
β-strand	152-156	5	28
β-strand	161-163	3	29
β-strand	168	1	30
β-strand	171-177	7	28
β-strand	180-184	5	29
β-strand	187-192	6	29
β-strand	197-198	2	28
α-helix	200-203	4
β-strand	208	1	30
β-strand	211-215	5	29
β-strand	219-225	7	28
α-helix	226-249	24
α-helix	252-254	3
α-helix	259-268	10
β-strand	270-274	5	31
β-strand	279-281	3	31
β-strand	286-287	2	32
β-strand	289-302	14	31
β-strand	311-316	6	31
β-strand	321-322	2	31
α-helix	325-327	3
β-strand	331-332	2	32
β-strand	336-349	14	31
α-helix	351-357	7
α-helix	360-364	5
α-helix	368-373	6

Chain G: 19 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	15-31	17
α-helix	40-42	3
β-strand	43-51	9	33
β-strand	56-62	7	33
β-strand	68-75	8	33
α-helix	76-81	6
α-helix	85-96	12
α-helix	104-105	2
β-strand	106-111	6	33
β-strand	115-120	6	33
α-helix	121-122	2
β-strand	127	1	34
α-helix	128-135	8
α-helix	140-159	20
β-strand	162-163	2	35
α-helix	169-171	3
β-strand	172-174	3	34
β-strand	180-182	3	34
α-helix	185-187	3
β-strand	189-190	2	35
β-strand	195	1	36
β-strand	199-200	2	37
α-helix	202-204	3
α-helix	207-210	4
β-strand	215	1	36
α-helix	219-233	15
α-helix	243-252	10
α-helix	263-272	10
α-helix	289-292	4
α-helix	295-297	3
α-helix	303-306	4
α-helix	344-347	4

Chain H: 13 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	95-97	3
β-strand	98-99	2	37
α-helix	106-108	3
α-helix	120-130	11
α-helix	134-137	4
α-helix	141-150	10
β-strand	152-156	5	38
β-strand	161-163	3	39
β-strand	168	1	40
β-strand	171-177	7	38
β-strand	180-184	5	39
β-strand	187-192	6	39
β-strand	197-198	2	38
α-helix	200-203	4
β-strand	208	1	40
β-strand	211-215	5	39
β-strand	219-225	7	38
α-helix	226-249	24
α-helix	252-254	3
α-helix	259-268	10
β-strand	270-274	5	41
β-strand	279-281	3	41
β-strand	286-287	2	42
β-strand	289-302	14	41
β-strand	311-316	6	41
β-strand	321-322	2	41
α-helix	324-328	5
β-strand	331-332	2	42
β-strand	336-349	14	41
α-helix	351-357	7
α-helix	360-364	5
α-helix	368-373	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
cAMP-dependent protein kinase catalytic subunit alpha	A, C, E, G	protein	350	Homo sapiens	P17612 (AlphaFold model)
cAMP-dependent protein kinase type I-alpha regulatory subunit	B, D, F, H	protein	380	Bos taurus	P00514 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>6NO7_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A, C, E, G)
GNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLV
KHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVM
EYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYI
QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA
DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATT
DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Sequence of entity 2 (B, D, F, H), FASTA

>6NO7_2 cAMP-dependent protein kinase type I-alpha regulatory subunit (chains B, D, F, H)
MASGTTASEEERSLRECELYVQKHNIQALLKDSIVQLCTARPERPMAFLREYFEKLEKEE
AKQIQNLQKAGSRADSREDEISPPPPNPVVKGRRRRGAISAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGE
MDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAA
VLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSDILKRNIQQYNSFVSLSV

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	4
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	2

Primary citation

Two PKA RI alpha holoenzyme states define ATP as an isoform-specific orthosteric inhibitor that competes with the allosteric activator, cAMP. Lu, T.W., Wu, J., Aoto, P.C. et al. Proc Natl Acad Sci U S A (2019) 116:16347-16356. DOI 10.1073/pnas.1906036116 · PubMed

Other PDB entries of the same protein (UniProt P17612 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WB8 1.55 Å, Crystal structure of human cAMP-dependent protein kinase A (catalytic alpha subunit),…
3OVV 1.58 Å, Human cAMP-dependent protein kinase in complex with an inhibitor
3POO 1.6 Å, human cAMP-dependent protein kinase in complex with an inhibitor
4WB5 1.64 Å, Crystal structure of human cAMP-dependent protein kinase A (catalytic alpha subunit)
6QJ7 1.69 Å, Difluorophenyl diacylhydrazides: Potent inhibitors of Serum- and…
3AMA 1.75 Å, Protein kinase A sixfold mutant model of Aurora B with inhibitor JNJ-7706621
4UJ1 1.77 Å, Protein Kinase A in complex with an Inhibitor
5IZJ 1.85 Å, Complex of PKA with the bisubstrate protein kinase inhibitor ARC-1411
4UJ9 1.87 Å, Protein Kinase A in complex with an Inhibitor
3OWP 1.88 Å, Human cAMP-dependent protein kinase in complex with an inhibitor
6FRX 1.88 Å, PKA variant as Aurora B mimic in complex with a dianilinopyrimidine inhibitor
5BX6 1.89 Å, PKA in complex with a halogenated phthalazinone fragment compound.

Browse structure collections

About this viewer

MolViewer shows 6NO7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.