Crystal structure of fast switching M159T mutant of fluorescent protein Dronpa (Dronpa2). Determined by X-ray diffraction at 2.0 Å resolution. Released 12 Jun 2019.
Explore 6NQJ in 3D Show helices and sheets RCSB PDB PDBe
6NQJ contains 24 α-helices and 52 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 1 |
| β-strand | 21-32 | 12 | 1 |
| β-strand | 37-46 | 10 | 1 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 55-58 | 4 | |
| β-strand | 70 | 1 | 1 |
| α-helix | 80-82 | 3 | |
| β-strand | 87-95 | 9 | 1 |
| β-strand | 100-110 | 11 | 1 |
| β-strand | 113-123 | 11 | 1 |
| β-strand | 136-139 | 4 | 1 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 1 |
| β-strand | 152-163 | 12 | 1 |
| β-strand | 168-179 | 12 | 1 |
| α-helix | 184-187 | 4 | |
| β-strand | 189-200 | 12 | 1 |
| β-strand | 206-216 | 11 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-18 | 11 | 2 |
| β-strand | 21-32 | 12 | 2 |
| β-strand | 37-46 | 10 | 2 |
| α-helix | 48 | 1 | |
| α-helix | 50 | 1 | |
| α-helix | 55-58 | 4 | |
| β-strand | 70 | 1 | 2 |
| α-helix | 78-81 | 4 | |
| β-strand | 87-95 | 9 | 2 |
| β-strand | 100-110 | 11 | 2 |
| β-strand | 113-123 | 11 | 2 |
| β-strand | 136-139 | 4 | 2 |
| α-helix | 140-141 | 2 | |
| β-strand | 142-149 | 8 | 2 |
| β-strand | 152-163 | 12 | 2 |
| β-strand | 168-179 | 12 | 2 |
| α-helix | 184-187 | 4 | |
| β-strand | 189-200 | 12 | 2 |
| β-strand | 206-216 | 11 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fluorescent protein Dronpa | A, B, C, D | protein | 255 | Echinophyllia sp. SC22 | Q5TLG6 (AlphaFold model) |
>6NQJ_1 Fluorescent protein Dronpa (chains A, B, C, D) GSSHHHHHHSSGLVPGGSHMVSKGEENNMAVIKPDMKIKLRMEGAVNGHPFAIEGVGLGK PFEGKQSMDLKVKEGGPLPFAYDILTTVFXNRVFAKYPENIVDYFKQSFPEGYSWERSMN YEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLK GDVNTALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAE AHSGLPRQAMDELYK
Electrostatic control of photoisomerization pathways in proteins. Romei, M.G., Lin, C.Y., Mathews, I.I. et al. Science (2020) 367:76-79. DOI 10.1126/science.aax1898 · PubMed
Other PDB entries of the same protein (UniProt Q5TLG6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NQJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.