Crystal Structure of human PARP-1 ART domain bound to inhibitor UTT103. Determined by X-ray diffraction at 2.0 Å resolution. Released 14 Aug 2019.
Explore 6NRF in 3D Show helices and sheets RCSB PDB PDBe
6NRF contains 15 α-helices and 17 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 769-779 | 11 | |
| α-helix | 790-796 | 7 | |
| β-strand | 799-803 | 5 | 1 |
| α-helix | 804-805 | 2 | |
| α-helix | 809-820 | 12 | |
| β-strand | 829-841 | 13 | 1 |
| α-helix | 844-848 | 5 | |
| α-helix | 849-851 | 3 | |
| β-strand | 857-863 | 7 | 1 |
| α-helix | 866-868 | 3 | |
| α-helix | 869-875 | 7 | |
| α-helix | 879-881 | 3 | |
| β-strand | 895-897 | 3 | 2 |
| β-strand | 898 | 1 | 1 |
| α-helix | 901-905 | 5 | |
| α-helix | 906-908 | 3 | |
| β-strand | 911 | 1 | 3 |
| β-strand | 914 | 1 | 3 |
| β-strand | 916-925 | 10 | 1 |
| β-strand | 929-932 | 4 | 2 |
| α-helix | 941-942 | 2 | |
| β-strand | 947-950 | 4 | 2 |
| β-strand | 952-956 | 5 | 4 |
| α-helix | 958-960 | 3 | |
| β-strand | 962-964 | 3 | 1 |
| β-strand | 967-969 | 3 | 1 |
| α-helix | 972-973 | 2 | |
| β-strand | 974-976 | 3 | 4 |
| β-strand | 984-986 | 3 | 4 |
| β-strand | 988-991 | 4 | 2 |
| α-helix | 994-996 | 3 | |
| β-strand | 997-1009 | 13 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Poly [ADP-ribose] polymerase 1 | A | protein | 271 | Homo sapiens | P09874 (AlphaFold model) |
>6NRF_1 Poly [ADP-ribose] polymerase 1 (chains A) MGSSHHHHHHSSGLVPRGSHMTKSKLPKPVQDLIKMIFGSGSGSGGDPIDVNYEKLKTDI KVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIEREGECQRYKPFKQLHNRRLLW HGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADMVSKSANYCHTSQGDPIGLILL GEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSANISLDGVDVPLGTGISSGVND TSLLYNEYIVYDIAQVNLKYLLKLKFNFKTS
| ID | Name | Formula | Copies |
|---|---|---|---|
| KYV | 2-({4-[4-(1H-benzimidazol-2-yl)piperazine-1-carbonyl]phenyl}methyl)-3-hydroxy-1… | C28 H25 N5 O4 | 1 |
| CIT | Citric acid | C6 H8 O7 | 1 |
Water and common crystallization additives (CL, DMS) are not listed.
Design and Synthesis of Poly(ADP-ribose) Polymerase Inhibitors: Impact of Adenosine Pocket-Binding Motif Appendage to the 3-Oxo-2,3-dihydrobenzofuran-7-carboxamide on Potency and Selectivity. Velagapudi, U.K., Langelier, M.F., Delgado-Martin, C. et al. J Med Chem (2019) 62:5330-5357. DOI 10.1021/acs.jmedchem.8b01709 · PubMed
Other PDB entries of the same protein (UniProt P09874 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6NRF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.