6O4P: Interleukin 11 alpha receptor

The crystal structure of the interleukin 11 alpha receptor. Determined by X-ray diffraction at 3.43 Å resolution. Released 6 May 2020.

Method: X-ray diffraction
Resolution: 3.43 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,580
Mol. weight: 78.87 kDa
Ligands: NAG
Released: 6 May 2020

Explore 6O4P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6O4P contains 18 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	13-16	4	1
β-strand	22-25	4	2
β-strand	35-39	5	1
β-strand	42	1	1
α-helix	49-51	3
β-strand	56-59	4	2
β-strand	69-74	6	1
β-strand	79-87	9	1
α-helix	90-92	3
β-strand	95-100	6	3
β-strand	106-111	6	3
β-strand	121-128	8	4
α-helix	142-145	4
β-strand	146-147	2	4
α-helix	149	1
β-strand	150	1	3
α-helix	151	1
β-strand	157-160	4	3
β-strand	168-177	10	4
β-strand	180-189	10	4
β-strand	194	1	3
α-helix	196-199	4
β-strand	200-207	8	5
β-strand	210-219	10	5
α-helix	225	1
β-strand	232-240	9	6
β-strand	247-249	3	6
β-strand	255-258	4	5
α-helix	261-262	2
β-strand	267-275	9	6
α-helix	282-288	7
β-strand	289-291	3	6

Chain B: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	13-16	4	7
β-strand	22-25	4	8
β-strand	35-39	5	7
β-strand	42-45	4	7
α-helix	49-51	3
β-strand	56-59	4	8
β-strand	68-74	7	7
β-strand	79-87	9	7
α-helix	90-92	3
β-strand	95-100	6	9
β-strand	106-111	6	9
β-strand	121-128	8	10
α-helix	143-145	3
β-strand	146-147	2	10
α-helix	149	1
β-strand	150	1	9
α-helix	151	1
β-strand	157-160	4	9
β-strand	168-177	10	10
β-strand	180-189	10	10
β-strand	194	1	9
α-helix	196-199	4
β-strand	200-207	8	11
β-strand	210-219	10	11
α-helix	225	1
β-strand	232-239	8	12
β-strand	247-249	3	12
β-strand	255-258	4	11
α-helix	261-262	2
β-strand	267-275	9	12
α-helix	282-288	7
β-strand	289-291	3	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-11 receptor subunit alpha	A, B	protein	349	Homo sapiens	Q14626 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6O4P_1 Interleukin-11 receptor subunit alpha (chains A, B)
SSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLA
QADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPT
RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLG
ASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPSQPHFLLKFRLQYRP
AQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPK
EIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDSVHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

The structure of the extracellular domains of human interleukin 11 alpha receptor reveals mechanisms of cytokine engagement. Metcalfe, R.D., Aizel, K., Zlatic, C.O. et al. J Biol Chem (2020) 295:8285-8301. DOI 10.1074/jbc.RA119.012351 · PubMed

Other PDB entries of the same protein (UniProt Q14626 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QY4 3.06 Å, Structure of interleukin 11 (gp130 P496L mutant).
8DPS 3.47 Å, The structure of the interleukin 11 signalling complex, truncated gp130
8DPU 3.78 Å, The crystal structure of the IL-11 signalling complex
8DPT 4.0 Å, The structure of the IL-11 signalling complex, with full-length extracellular gp130

Browse structure collections

About this viewer

MolViewer shows 6O4P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.