6OA6: Actin-binding domain of human alpha-actinin-4

Crystal structure of the actin-binding domain of human alpha-actinin-4. Determined by X-ray diffraction at 1.37 Å resolution. Released 18 Mar 2020.

Method: X-ray diffraction
Resolution: 1.37 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,240
Mol. weight: 26.83 kDa
Released: 18 Mar 2020

Explore 6OA6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OA6 contains 16 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	47-64	18
α-helix	65-67	3
α-helix	82-92	11
α-helix	95-100	6
α-helix	105-121	17
α-helix	131-136	6
α-helix	139-150	12
α-helix	151-155	5
β-strand	159-160	2	1
β-strand	163-164	2	1
α-helix	165-177	13
α-helix	190-192	3
α-helix	196-205	10
α-helix	207-209	3
α-helix	212-214	3
α-helix	220-234	15
α-helix	243-248	6
α-helix	254-268	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-actinin-4	A	protein	234	Homo sapiens	O43707 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6OA6_1 Alpha-actinin-4 (chains A)
GGAMDPEFAWEKQQRKTFTAWCNSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPK
PERGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDI
DVEETSAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKD
DPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSSFYHAFSGAL

Primary citation

Phosphorylation of ACTN4 Leads to Podocyte Vulnerability and Proteinuric Glomerulosclerosis. Feng, D., Kumar, M., Muntel, J. et al. J Am Soc Nephrol (2020) 31:1479-1495. DOI 10.1681/ASN.2019101032 · PubMed

Other PDB entries of the same protein (UniProt O43707 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6O31 1.51 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4
1YDI 1.8 Å, Human Vinculin Head Domain (VH1, 1-258) in Complex with Human Alpha-Actinin's…
2R0O 2.2 Å, Crystal structure of the actin-binding domain of human alpha-actinin-4 mutant(K255E)
1WLX Solution structure of the third spectrin repeat of alpha-actinin-4

Browse structure collections

About this viewer

MolViewer shows 6OA6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.