6OCB: FluA-20 Fab

Crystal structure of FluA-20 Fab in complex with the head domain of H3 (A/Hong Kong/1/1968). Determined by X-ray diffraction at 2.1 Å resolution. Released 29 May 2019.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, Influenza A virus
Chains: 3
Atoms: 5,746
Mol. weight: 79.27 kDa
Ligands: NAG
Released: 29 May 2019

Explore 6OCB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OCB contains 23 α-helices and 76 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	44	1	12
β-strand	51-54	4	13
β-strand	58-60	3	14
α-helix	66-71	6
α-helix	74-79	6
β-strand	83	1	15
β-strand	86-89	4	14
β-strand	100-101	2	16
α-helix	105-115	11
β-strand	117	1	15
β-strand	120-122	3	16
β-strand	130-131	2	17
β-strand	136-141	6	18
β-strand	144-146	3	18
β-strand	151-153	3	16
β-strand	155-156	2	17
β-strand	157	1	19
β-strand	160	1	19
β-strand	164-169	6	20
β-strand	176-184	9	16
α-helix	188-195	8
β-strand	202-205	4	20
β-strand	210-213	4	20
β-strand	223	1	21
β-strand	226	1	21
β-strand	229-237	9	16
β-strand	242-247	6	20
β-strand	251-254	4	16
β-strand	256-259	4	16
β-strand	266-269	4	14
α-helix	272-273	2
β-strand	274-278	5	13
β-strand	282-283	2	22
β-strand	286-287	2	22
β-strand	294-295	2	12
β-strand	302	1	22
α-helix	306	1
β-strand	307-308	2	12

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	11-12	2	2
β-strand	18-25	8	1
β-strand	34-39	8	3
β-strand	46-52	7	3
β-strand	57-59	3	3
β-strand	67-72	6	1
β-strand	77-82	6	1
α-helix	84-86	3
β-strand	88-96	9	3
β-strand	102-103	2	3
β-strand	107-109	3	3
β-strand	110-111	2	2
α-helix	115-116	2
β-strand	117	1	4
α-helix	118-119	2
β-strand	120-124	5	5
β-strand	135-145	11	5
β-strand	146	1	4
β-strand	151-154	4	6
β-strand	159	1	6
β-strand	163-165	3	5
α-helix	166-168	3
β-strand	169-170	2	5
β-strand	176-185	10	5
α-helix	186-188	3
β-strand	195-200	6	6
α-helix	201-203	3
β-strand	205-210	6	6

Chain L: 11 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	7
β-strand	10-14	5	8
β-strand	19-25	7	7
β-strand	33-38	6	8
α-helix	43-44	2
β-strand	45-49	5	8
β-strand	53-54	2	8
α-helix	55	1
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-90	7	8
α-helix	96	1
β-strand	97-98	2	8
β-strand	102-107	6	8
β-strand	111	1	9
α-helix	112-113	2
β-strand	114-118	5	10
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	10
β-strand	140	1	9
β-strand	144-150	7	11
β-strand	153-154	2	11
α-helix	155	1
β-strand	159-163	5	10
α-helix	164-167	4
β-strand	173-182	10	10
α-helix	183-187	5
β-strand	191-198	8	11
β-strand	205-210	6	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heavy chain of FluA-20 Fab	H	protein	235	Homo sapiens
Light chain of FluA-20 Fab	L	protein	214	Homo sapiens
Hemagglutinin	A	protein	274	Influenza A virus	Q91MA7

Sequence of entity 1 (H), FASTA

>6OCB_1 Heavy chain of FluA-20 Fab (chains H)
QVQLEESGPGLVKPSETLSLTCSVSGVSVTSDIYYWTWIRQPPGKGLEWIGYIFYNGDTN
YNPSLKSRVTMSIDTSKNEFSLRLTSVTAADTAVYFCARGTEDLGYCSSGSCPNHWGQGT
LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCHHHHHH

Sequence of entity 2 (L), FASTA

>6OCB_2 Light chain of FluA-20 Fab (chains L)
DIVMTQSPSSLSASIGDRVTITCRPSQNIRSFLNWFQHKPGKAPKLLIYAASNLQSGVPS
RFSGSGSGTEFTLTIRSLQPEDFATYYCQQSYNTPPTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (A), FASTA

>6OCB_3 Hemagglutinin (chains A)
VQSSSTGKICNNPHRILDGIDCTLIDALLGDPHCDVFQNETWDLFVERSKAFSNCYPYDV
PDYASLRSLVASSGTLEFITEGFTWTGVTQNGGSNACKRGPGSGFFSRLNWLTKSGSTYP
VLNVTMPNNDNFDKLYIWGVHHPSTNQEQTSLYVQASGRVTVSTRRSQQTIIPNIGSRPW
VRGLSSRISIYWTIVKPGDVLVINSNGNLIAPRGYFKMRTGKSSIMRSDAPIDTCISECI
TPNGSIPNDKPFQNVNKITYGACPKYVGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

A Site of Vulnerability on the Influenza Virus Hemagglutinin Head Domain Trimer Interface. Bangaru, S., Lang, S., Schotsaert, M. et al. Cell (2019) 177:1136-1152.e18. DOI 10.1016/j.cell.2019.04.011 · PubMed

Other PDB entries of the same protein (UniProt Q91MA7), best resolution first:

4FNK 1.9 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin
8IB1 1.95 Å, Structure of the LAH31 Fab bound to an influenza virus HA epitope peptide
5UMN 1.97 Å, Crystal structure of C05 VPGSGW mutant bound to H3 influenza hemagglutinin, HA1 subunit
6NHR 2.1 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA2…
5VTZ 2.15 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin…
7QA4 2.19 Å, Crystal structure of stabilized H3N2 A/Hong Kong/1/1968 Hemagglutinin at 2.2 Angstrom
6BKM 2.2 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D…
6TZB 2.24 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin in…
5VTV 2.25 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin…
5VU4 2.25 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin…
6BKQ 2.25 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin E190D…
6NHP 2.25 Å, Crystal structure of the A/Hong Kong/1/1968 (H3N2) influenza virus hemagglutinin HA2…

Browse structure collections

About this viewer

MolViewer shows 6OCB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.