6ODD: Human complex ACP-ISD11

Crystal structure of the human complex ACP-ISD11. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Nov 2019.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,374
Mol. weight: 19.26 kDa
Ligands: CA, 8Q1
Released: 27 Nov 2019

Explore 6ODD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6ODD contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	9-21	13
α-helix	28-30	3
α-helix	45-59	15
α-helix	65-68	4
α-helix	74-84	11

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	19-33	15
α-helix	39-54	16
α-helix	62-88	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Acyl carrier protein, mitochondrial	A	protein	85	Homo sapiens	O14561 (AlphaFold model)
LYR motif-containing protein 4	B	protein	74	Homo sapiens	Q9HD34 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6ODD_1 Acyl carrier protein, mitochondrial (chains A)
PPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIP
DIDAEKLMCPQEIVDYIADKKDVYE

Sequence of entity 2 (B), FASTA

>6ODD_2 LYR motif-containing protein 4 (chains B)
SRAQVLSLYRAMLRESKRFSAYNYRTYAVRRIRDAFRENKNVKDPVEIQTLVNKAKRDLG
VIRRQVHIGQLYST

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1
8Q1	S-[2-({N-[(2R)-2-hydroxy-3,3-dimethyl-4-(phosphonooxy)butanoyl]-beta-alanyl}ami…	C23 H45 N2 O8 P S	1

Primary citation

Structure of the Human ACP-ISD11 Heterodimer. Herrera, M.G., Noguera, M.E., Sewell, K.E. et al. Biochemistry (2019) 58:4596-4609. DOI 10.1021/acs.biochem.9b00539 · PubMed

Other PDB entries of the same protein (UniProt O14561 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OF0 2.2 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
9N51 2.31 Å, Crosslinked Crystal Structure of Human Mitochondrial Ketosynthase, OXSM, and…
8QU5 2.42 Å, mt-LSU assembly intermediate in GTPBP8 knock-out cells, state 2
7OF7 2.5 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
9N50 2.5 Å, Crosslinked Crystal Structure of Human Mitochondrial Ketosynthase, OXSM, and…
7PO4 2.56 Å, Assembly intermediate of human mitochondrial ribosome large subunit (largely unfolded…
7O9M 2.6 Å, Human mitochondrial ribosome large subunit assembly intermediate with MTERF4-NSUN4,…
9I4I 2.63 Å, High resolution Cryo-EM structure of human complex I in mitochondria
9TI4 2.66 Å, High resolution Cryo-EM structure of human complex I in mitochondria
7OF2 2.7 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
7OF3 2.7 Å, Structure of a human mitochondrial ribosome large subunit assembly intermediate in…
9PRA 2.83 Å, In Situ Structure of the Human Mitoribosome Large Subunit 39S in Complex with EF-Tu

Browse structure collections

About this viewer

MolViewer shows 6ODD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.