6OEU: Human Patched1

Structure of human Patched1. Determined by electron microscopy at 3.5 Å resolution. Released 10 Apr 2019.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 1
Atoms: 7,310
Mol. weight: 163.41 kDa
Released: 10 Apr 2019

Explore 6OEU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OEU contains 42 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 42 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	78-93	16
α-helix	102-115	14
α-helix	135-145	11
β-strand	153-154	2	1
β-strand	157-161	5	2
α-helix	172-186	15
β-strand	203	1	1
α-helix	216-221	6
α-helix	231-234	4
β-strand	246	1	3
β-strand	254	1	3
α-helix	262-270	9
α-helix	276-282	7
β-strand	328	1	4
β-strand	336	1	4
α-helix	339-342	4
β-strand	343-344	2	2
β-strand	347	1	5
β-strand	354	1	5
β-strand	359-362	4	2
β-strand	366-367	2	1
α-helix	368	1
α-helix	369-375	7
α-helix	389-408	20
β-strand	418-422	5	2
α-helix	425-435	11
α-helix	437-438	2
α-helix	439-455	17
α-helix	470-490	21
α-helix	493-495	3
α-helix	503-524	22
α-helix	536-560	25
α-helix	568-601	34
α-helix	733-740	8
α-helix	747-769	23
α-helix	777-779	3
α-helix	786-797	12
β-strand	800-801	2	6
β-strand	804-807	4	7
α-helix	817-824	8
β-strand	832	1	6
β-strand	835	1	8
β-strand	839	1	8
α-helix	840-842	3
α-helix	844-865	22
α-helix	878-886	9
α-helix	919-929	11
α-helix	931-937	7
α-helix	944-946	3
α-helix	967-969	3
β-strand	972-975	4	7
β-strand	978-979	2	6
α-helix	986-1003	18
β-strand	1008-1011	4	7
α-helix	1014-1017	4
α-helix	1024-1047	24
α-helix	1050-1074	25
α-helix	1080-1101	22
α-helix	1103-1105	3
α-helix	1113-1137	25
α-helix	1138-1141	4
α-helix	1148-1154	7
α-helix	1155-1174	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein patched homolog 1	A	protein	1455	Homo sapiens	Q13635 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6OEU_1 Protein patched homolog 1 (chains A)
MASAGNAAEPQDRGGGGSGCIGAPGRPAGGGRRRRTGGLRRAAAPDRDYLHRPSYCDAAF
ALEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAAN
LETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLD
SALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAK
LQSGTAYLLGKPPLRWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPA
DPDCPATAPNKNSTKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHAL
QTMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVL
SFTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALS
VAAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGEC
LKRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDL
YRREDRRLDIFCCFTSPCVSRVIQVEPQAYTDTHDNTRYSPPPPYSSHSFAHETQITMQS
TVQLRTEYDPHTHVYYTTAEPRSEISVQPVTVTQDTLSCQSPESTSSTRDLLSQFSDSSL
HCLEPPCTKWTLSSFAEKHYAPFLLKPKAKVVVIFLFLGLLGVSLYGTTRVRDGLDLTDI
VPRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHRSFSNVKYVMLEENKQL
PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDIS
QLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETR
LRIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICSNYTSLGLSSYPNGYPFLFWEQ
YIGLRHWLLLFISVVLACTFLVCAVFLLNPWTAGIIVMVLALMTVELFGMMGLIGIKLSA
VPVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLML
AGSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEP
PPSVVRFAMPPGHTHSGSDSSDSEYSSQTTVSGLSEELRHYEAQQGAGGPAHQVIVEATE
NPVFAHSTVVHPESRHHPPSNPRQQPHLDSGSLPPGRQGQQPRRDPPREGLWPPPYRPRR
DAFEISTEGHSGPSNRARWGPRGARSHNPRNPASTAMGSSVPGYCQPITTVTASASVTVA
VHPPPVPGPGRNPRGGLCPGYPETDHGLFEDPHVPFHVRCERRDSKVEVIELQDVECEER
PRGSSSNDYKDDDDK

Primary citation

Structures of human Patched and its complex with native palmitoylated sonic hedgehog. Qi, X., Schmiege, P., Coutavas, E. et al. Nature (2018) 560:128-132. DOI 10.1038/s41586-018-0308-7 · PubMed

Other PDB entries of the same protein (UniProt Q13635 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6RTW 1.9 Å, Crystal structure of the Patched-1 (PTCH1) ectodomain in complex with nanobody NB64 and…
6RTX 1.95 Å, Crystal structure of the Patched-1 (PTCH1) ectodomain 1
6RTY 2.1 Å, Crystal structure of the Patched ectodomain in complex with nanobody NB64
6RVC 2.2 Å, Crystal structure of Patched-1 ectodomain 2 (PTCH1-ECD2) in complex with nanobody 75
6RMG 3.4 Å, Structure of PTCH1 bound to a modified Hedgehog ligand ShhN-C24II
6E1H 3.5 Å, Structure of 2:1 human Ptch1-Shh-N complex
6RVD 3.5 Å, Revised cryo-EM structure of the human 2:1 Ptch1-Shh complex
6DMY 3.6 Å, Cryo-EM structure of human Ptch1 and ShhN complex
6N7H 3.6 Å, Cryo-EM structure of the 2:1 hPtch1-Shhp complex
9MS8 3.73 Å, PTCH1 in complex with Fab6H3
6OEV 3.8 Å, Structure of human Patched1 in complex with native Sonic Hedgehog
6DMB 3.9 Å, Cryo-EM structure of human Ptch1

Browse structure collections

About this viewer

MolViewer shows 6OEU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.