6OFK: PDB entry 6OFK

Name: PDB 6OFK: Crystal structure of green fluorescent protein (GFP); S65T; ih circular permutant (50-51)
Published: 2019-07-10
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Crystal structure of green fluorescent protein (GFP); S65T; ih circular permutant (50-51). Determined by X-ray diffraction at 1.15 Å resolution. Released 10 Jul 2019.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Aequorea victoria
Chains: 2
Atoms: 4,186
Mol. weight: 56.23 kDa
Released: 10 Jul 2019

Explore 6OFK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OFK contains 14 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	19-21	3
β-strand	23	1	1
α-helix	26-31	6
α-helix	33-36	4
β-strand	42-50	9	1
β-strand	55-65	11	1
β-strand	68-78	11	1
β-strand	91	1	2
β-strand	99-105	7	1
α-helix	106-108	3
β-strand	110-120	11	1
β-strand	121	1	2
β-strand	126-137	12	1
α-helix	144-147	4
β-strand	149-158	10	1
β-strand	167-177	11	1
α-helix	197-201	5
β-strand	204-215	12	1
β-strand	218-229	12	1
β-strand	234-240	7	1

Chain B: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	19-21	3
β-strand	23	1	3
α-helix	26-31	6
α-helix	33-36	4
β-strand	42-50	9	3
β-strand	55-65	11	3
β-strand	68-78	11	3
β-strand	91	1	4
β-strand	99-105	7	3
α-helix	106-108	3
β-strand	110-120	11	3
β-strand	121	1	4
β-strand	126-137	12	3
α-helix	144-147	4
β-strand	149-158	10	3
β-strand	167-177	11	3
α-helix	196-199	4
β-strand	204-215	12	3
β-strand	218-229	12	3
β-strand	234-241	8	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green Fluorescent Protein (GFP); S65T; ih circular permutant (50-51)	A, B	protein	251	Aequorea victoria	P42212 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6OFK_1 Green Fluorescent Protein (GFP); S65T; ih circular permutant (50-51) (chains A, B)
GHHHHHHSSGGKLPVPWPTLVTTLXVQCFSRYPDHMKRHDFFKSAMPEGYVQERTISFKD
DGKYKTRAVVKFEGDTLVNRIELKGTDFKEDGNILGHKLEYNFNSHNVYITADKQKNGIK
ANFTVRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQTVLSKDPNEKRDHMVLLE
FVTAAGITHGMDELYGGTGGSASQGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATI
GKLTLKFISTT

Primary citation

Unified Model for Photophysical and Electro-Optical Properties of Green Fluorescent Proteins. Lin, C.Y., Romei, M.G., Oltrogge, L.M. et al. J Am Chem Soc (2019) 141:15250-15265. DOI 10.1021/jacs.9b07152 · PubMed

Other PDB entries of the same protein (UniProt P42212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L27 0.77 Å, X-ray crystal structure of the mutant green fluorescent protein
6JGJ 0.78 Å, Crystal structure of the F99S/M153T/V163A/E222Q variant of GFP at 0.78 A
6KL0 0.8 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 7.0
6JGI 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of GFP at 0.85 A
6KL1 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of non-deuterated GFP at pD 8.5
2WUR 0.9 Å, Atomic resolution structure of GFP measured on a rotating anode
6KKZ 0.9 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 8.5
6JGH 0.94 Å, Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A
4AS8 1.02 Å, X-ray structure of the cyan fluorescent protein Cerulean cryoprotected with ethylene…
5OXC 1.02 Å, Structure of Cerulean Fluorescent Protein at 1.02 Angstrom resolution
7PCA 1.05 Å, Functional and structural characterization of redox sensitive superfolder green…
4GF6 1.1 Å, crystal structure of GFP with cuprum bound at the Incorporated metal Chelating Amino…

Browse structure collections

About this viewer

MolViewer shows 6OFK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.