6OLU: PDB entry 6OLU

RIAM RA-PH core structure in the P212121 space group. Determined by X-ray diffraction at 1.9 Å resolution. Released 22 Apr 2020.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Mus musculus
Chains: 1
Atoms: 2,319
Mol. weight: 31.05 kDa
Released: 22 Apr 2020

Explore 6OLU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6OLU contains 12 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	180-186	7	1
α-helix	187	1
β-strand	192-198	7	1
β-strand	202	1	2
α-helix	203-214	12
β-strand	222-228	7	1
β-strand	233-236	4	1
α-helix	237-238	2
β-strand	242	1	2
α-helix	243-247	5
β-strand	257-262	6	1
α-helix	268-271	4
α-helix	273-275	3
α-helix	295-306	12
β-strand	317-323	7	1
α-helix	324	1
β-strand	330-337	8	1
β-strand	341-344	4	1
α-helix	345-346	2
β-strand	357-361	5	1
β-strand	366-370	5	1
α-helix	373-377	5
β-strand	383-388	6	1
β-strand	400-404	5	1
α-helix	407-422	16
α-helix	424-434	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid beta A4 precursor protein-binding family B member 1-interacting protein	A	protein	262	Mus musculus	Q8R5A3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6OLU_1 Amyloid beta A4 precursor protein-binding family B member 1-interacting protein (chains A)
GSHKKLVVKVHMDDSSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIER
VFEDHENVVEVLSDWTRDTENKVLFLEKEERYAVFKNPQNFYLDNKGKKENKETNEKMNA
KNKEYLLEESFCGTSIIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRD
LACFIQFENVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLSQWVM
GIRIAKYGKTLYDNYQRAVARA

Primary citation

Phosphorylation of RIAM by src promotes integrin activation by unmasking the PH domain of RIAM. Cho, E.A., Zhang, P., Kumar, V. et al. Structure (2021) 29:320. DOI 10.1016/j.str.2020.11.011 · PubMed

Other PDB entries of the same protein (UniProt Q8R5A3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
4KVG 1.65 Å, Crystal structure of RIAM RA-PH domains in complex with GTP bound Rap1
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3TCA 2.35 Å, Crystal structure of the Ras-associating and pleckstrin-homology domains of RIAM
6O6H 2.5 Å, RIAM cc-RA-PH structure in the P21212 space group

Browse structure collections

About this viewer

MolViewer shows 6OLU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.