6P0Z: N-acetylated KRAS

Crystal structure of N-acetylated KRAS (2-169) bound to GDP and Mg. Determined by X-ray diffraction at 1.01 Å resolution. Released 31 Jul 2019.

Method: X-ray diffraction
Resolution: 1.01 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,395
Mol. weight: 39.41 kDa
Ligands: MG, GDP, ACE
Released: 31 Jul 2019

Explore 6P0Z in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6P0Z contains 10 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	16-25	10
β-strand	38-46	9	1
β-strand	49-57	9	1
α-helix	65-74	10
β-strand	77-83	7	1
α-helix	87-104	18
β-strand	111-116	6	1
α-helix	127-137	11
β-strand	141-143	3	1
α-helix	152-167	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GTPase KRas	A, B	protein	168	Homo sapiens	P01116 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6P0Z_1 GTPase KRas (chains A, B)
TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQ
EEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLP
SRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	2
ACE	Acetyl group	C2 H4 O	2

Water and common crystallization additives (PEG) are not listed.

Primary citation

Structures of N-terminally processed KRAS provide insight into the role of N-acetylation. Dharmaiah, S., Tran, T.H., Messing, S. et al. Sci Rep (2019) 9:10512-10512. DOI 10.1038/s41598-019-46846-w · PubMed

Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IAY 0.95 Å, Structure of 10 in complex with GDP-KRAS
9IAW 1.0 Å, Structure of 5 in complex with GDP-KRAS
12XE 1.01 Å, Crystal structure of KRAS(Q61K) bound to GppNHp and ligand
8ONV 1.01 Å, KRAS-G13D in complex with BI-2493
9IB5 1.01 Å, Structure of 18 (BI-2493) in complex with GDP-KRAS
8AZZ 1.02 Å, KRAS-G12V in complex with BI-2865
8AZX 1.04 Å, KRAS-G12C in complex with BI-2865
8B00 1.04 Å, KRAS-G13D in complex with BI-2865
8TVK 1.04 Å, KRAS 1-169 G12C Mutant at 100k
4QL3 1.04 Å, Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
8AZV 1.05 Å, KRAS in complex with BI-2865
9IB4 1.06 Å, Structure of 12 in complex with GDP-KRAS

Browse structure collections

About this viewer

MolViewer shows 6P0Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.