6P6X: Ion transport protein

Crystal structure of voltage-gated sodium channel NavAb G94C/Q150C mutant in the activated state. Determined by X-ray diffraction at 2.75 Å resolution. Released 14 Aug 2019.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Arcobacter butzleri (strain RM4018)
Chains: 1
Atoms: 2,167
Mol. weight: 37.15 kDa
Ligands: CPS, PX4
Released: 14 Aug 2019

Explore 6P6X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6P6X contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	1000-1009	10
α-helix	1012-1031	20
α-helix	1035-1067	33
α-helix	1068-1073	6
α-helix	1075-1086	12
α-helix	1098-1101	4
α-helix	1102-1107	6
α-helix	1108-1112	5
α-helix	1114-1125	12
α-helix	1128-1130	3
α-helix	1131-1152	22
α-helix	1157-1160	4
α-helix	1163-1174	12
α-helix	1179-1184	6
α-helix	1185-1188	4
α-helix	1192-1194	3
α-helix	1195-1227	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ion transport protein	A	protein	257	Arcobacter butzleri (strain RM4018)	A8EVM5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6P6X_1 Ion transport protein (chains A)
MDYKDDDDKGSLVPRGSHMYLRITNIVESSFFTKFIIYLIVLNGITMGLETSKTFMQSFG
VYTTLFNQIVITIFTIEIILRIYVHRISFFKDPWSLFDFFVVAISLVPTSSCFEILRVLR
VLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATCLFGERFPEWFGT
LGESFYTLFQVMTLESWSMGIVRPLMEVYPYAWVFFIPFIFVVTFVMINLVVAIIVDAMA
ILNQKEEQHIIDEVQSH

Ligands and cofactors

ID	Name	Formula	Copies
CPS	3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate	C32 H58 N2 O7 S	2
PX4	1,2-dimyristoyl-sn-glycero-3-phosphocholine	C36 H73 N O8 P	9

Primary citation

Resting-State Structure and Gating Mechanism of a Voltage-Gated Sodium Channel. Wisedchaisri, G., Tonggu, L., McCord, E. et al. Cell (2019) 178:993. DOI 10.1016/j.cell.2019.06.031 · PubMed

Other PDB entries of the same protein (UniProt A8EVM5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MWD 2.33 Å, NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206S
6MWA 2.4 Å, NavAb Voltage-gated Sodium Channel, residues 1-239
9UC1 2.5 Å, Crystal structure of voltage-gated sodium channel NavAb N49K/S178T mutant
6MWG 2.5 Å, NavAb Voltage-gated Sodium Channel, residues 1-239, with mutation T206V
6C1M 2.52 Å, NavAb NormoPP mutant
8DIV 2.54 Å, Crystal structure of NavAb I22V as a basis for the human Nav1.7 Inherited…
6MWB 2.6 Å, NavAb Voltage-gated Sodium Channel, residues 1-239 with mutation T206A
8VGL 2.6 Å, CryoEM structure of Nav1.7 in complex with wild type Fab 7A9
8VGM 2.6 Å, CryoEM structure of Nav1.7 in complex with engineered conformationally rigid Fab 7A9.4DS
3RVY 2.7 Å, Crystal structure of the NavAb voltage-gated sodium channel (Ile217Cys, 2.7 A)
5KLB 2.7 Å, Crystal structure of the CavAb voltage-gated calcium channel(wild-type, 2.7A)
6C1K 2.7 Å, HypoPP mutant with ligand1

Browse structure collections

About this viewer

MolViewer shows 6P6X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.