Co-crystal Structure of human SMYD3 with Isoxazole Amides Inhibitors. Determined by X-ray diffraction at 1.19 Å resolution. Released 15 Jan 2020.
Explore 6P7Z in 3D Show helices and sheets RCSB PDB PDBe
6P7Z contains 24 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-10 | 5 | 1 |
| β-strand | 16-20 | 5 | 1 |
| β-strand | 24 | 1 | 2 |
| β-strand | 29-33 | 5 | 3 |
| β-strand | 37-40 | 4 | 4 |
| α-helix | 42-44 | 3 | |
| β-strand | 45 | 1 | 5 |
| β-strand | 48 | 1 | 5 |
| β-strand | 55 | 1 | 5 |
| β-strand | 60-61 | 2 | 6 |
| α-helix | 62 | 1 | |
| β-strand | 69-70 | 2 | 6 |
| α-helix | 73-92 | 20 | |
| α-helix | 100-114 | 15 | |
| α-helix | 116-118 | 3 | |
| α-helix | 119-121 | 3 | |
| α-helix | 126-128 | 3 | |
| α-helix | 133-135 | 3 | |
| α-helix | 138-154 | 17 | |
| α-helix | 162-164 | 3 | |
| α-helix | 171-181 | 11 | |
| β-strand | 183-186 | 4 | 4 |
| β-strand | 192-197 | 6 | 4 |
| α-helix | 201-203 | 3 | |
| α-helix | 204 | 1 | |
| β-strand | 205-206 | 2 | 7 |
| β-strand | 212-217 | 6 | 3 |
| β-strand | 220-225 | 6 | 3 |
| β-strand | 229 | 1 | 2 |
| α-helix | 233 | 1 | |
| β-strand | 234-235 | 2 | 1 |
| β-strand | 236-237 | 2 | 7 |
| α-helix | 246-257 | 12 | |
| α-helix | 264-268 | 5 | |
| α-helix | 272-275 | 4 | |
| α-helix | 280-298 | 19 | |
| α-helix | 302-313 | 12 | |
| α-helix | 325-341 | 17 | |
| α-helix | 344-361 | 18 | |
| α-helix | 367-382 | 16 | |
| α-helix | 386-403 | 18 | |
| α-helix | 409-426 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase SMYD3 | A | protein | 432 | Homo sapiens | Q9H7B4 (AlphaFold model) |
>6P7Z_1 Histone-lysine N-methyltransferase SMYD3 (chains A) GSFTMEPLKVEKFATANRGNGLRAVTPLRPGELLFRSDPLAYTVCKGSRGVVCDRCLLGK EKLMRCSQCRVAKYCSAKCQKKAWPDHKRECKCLKSCKPRYPPDSVRLLGRVVFKLMDGA PSESEKLYSFYDLESNINKLTEDKKEGLRQLVMTFQHFMREEIQDASQLPPAFDLFEAFA KVICNSFTICNAEMQEVGVGLYPSISLLNHSCDPNCSIVFNGPHLLLRAVRDIEVGEELT ICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKEVQESLKKIEEL KAHWKWEQVLAMCQAIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALFYGTRTME PYRIFFPGSHPVRGVQVMKVGKLQLHQGMFPQAMKNLRLAFDIMRVTHGREHSLIEDLIL LLEECDANIRAS
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
| MG | Magnesium ion | Mg | 2 |
| SAM | S-adenosylmethionine | C15 H22 N6 O5 S | 1 |
| O41 | 5-cyclopropyl-N-[1-(methylsulfonyl)piperidin-4-yl]-1,2-oxazole-3-carboxamide | C13 H19 N3 O4 S | 1 |
Discovery of Isoxazole Amides as Potent and Selective SMYD3 Inhibitors. Su, D.S., Qu, J., Schulz, M. et al. ACS Med Chem Lett (2020) 11:133-140. DOI 10.1021/acsmedchemlett.9b00493 · PubMed
Other PDB entries of the same protein (UniProt Q9H7B4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6P7Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.