6PSR: DNA-directed RNA polymerase subunit alpha

Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1) with TraR and rpsT P2 promoter. Determined by electron microscopy at 3.4 Å resolution. Released 25 Mar 2020.

Method: Electron microscopy
Resolution: 3.4 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,186
Mol. weight: 562.9 kDa
Ligands: 1N7, ZN, MG
Released: 25 Mar 2020

Explore 6PSR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSR contains 170 α-helices and 227 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	13-17	5	1
β-strand	23-31	9	1
α-helix	35-49	15
β-strand	52-53	2	2
β-strand	56-61	6	3
β-strand	74	1	4
α-helix	78-85	8
β-strand	90-92	3	5
β-strand	97-105	9	3
β-strand	108-111	4	4
α-helix	112-114	3
α-helix	116-117	2
β-strand	121-123	3	5
β-strand	129-133	5	4
β-strand	139-147	9	3
β-strand	149-150	2	2
β-strand	153	1	6
α-helix	155-158	4
β-strand	170-172	3	3
α-helix	173-174	2
β-strand	175	1	6
β-strand	180	1	7
β-strand	184-189	6	1
β-strand	199-206	8	1
β-strand	207	1	7
α-helix	213-231	19

Chain H: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	16-18	3	8
β-strand	23-31	9	8
α-helix	32	1
α-helix	35-49	15
β-strand	53-61	9	9
α-helix	78-86	9
β-strand	90-92	3	10
β-strand	97-101	5	9
β-strand	104-105	2	11
β-strand	109-111	3	12
α-helix	112-114	3
β-strand	121-123	3	10
β-strand	129-132	4	12
β-strand	139-140	2	11
β-strand	142-149	8	9
β-strand	153	1	13
β-strand	172	1	9
β-strand	175	1	13
β-strand	180-183	4	8
β-strand	188	1	14
β-strand	199	1	8
β-strand	200	1	14
β-strand	201-207	7	8
α-helix	213-227	15

Chain I: 59 helices, 97 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	13-14	2	15
α-helix	19-20	2
α-helix	29-38	10
α-helix	49-56	8
β-strand	59	1	16
β-strand	66-75	10	16
α-helix	76-78	3
α-helix	82-87	6
β-strand	93-104	12	16
β-strand	116-128	13	16
β-strand	136-137	2	17
β-strand	142-145	4	17
β-strand	147-148	2	18
β-strand	149-151	3	19
β-strand	154-158	5	20
α-helix	164-166	3
α-helix	169-171	3
β-strand	173-177	5	20
β-strand	180	1	21
β-strand	184-187	4	20
β-strand	195-196	2	22
β-strand	197	1	20
β-strand	204-205	2	22
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-231	5	23
β-strand	238-240	3	23
α-helix	244-246	3
β-strand	256-257	2	24
β-strand	260-261	2	24
α-helix	268-270	3
α-helix	271-279	9
β-strand	284-285	2	23
α-helix	289-292	4
β-strand	296	1	25
β-strand	297	1	23
β-strand	301	1	26
β-strand	311	1	26
β-strand	316	1	25
α-helix	319-327	9
β-strand	333-336	4	23
α-helix	347-352	6
α-helix	359-370	12
α-helix	375-376	2
α-helix	378-386	9
β-strand	396	1	21
α-helix	399-408	10
α-helix	422-437	16
β-strand	451-453	3	19
α-helix	456-480	25
α-helix	496-506	11
β-strand	512-514	3	17
α-helix	520-526	7
β-strand	529	1	27
β-strand	530-531	2	18
α-helix	552-554	3
β-strand	558	1	28
β-strand	574	1	27
β-strand	575	1	28
β-strand	576	1	29
β-strand	580-581	2	30
α-helix	586	1
β-strand	587-588	2	30
β-strand	589-594	6	31
β-strand	598	1	32
β-strand	599-606	8	31
α-helix	610-612	3
β-strand	616	1	31
β-strand	628	1	32
β-strand	633-639	7	31
β-strand	641-646	6	31
α-helix	647-649	3
β-strand	652-654	3	31
α-helix	657-659	3
β-strand	662	1	29
α-helix	664-666	3
α-helix	671-673	3
β-strand	674	1	33
α-helix	676-686	11
β-strand	689	1	34
α-helix	704-711	8
β-strand	716-717	2	35
β-strand	722-726	5	36
β-strand	731-736	6	36
α-helix	738-740	3
β-strand	749-752	4	36
β-strand	757-758	2	37
β-strand	763	1	38
β-strand	764-765	2	37
β-strand	768-769	2	35
β-strand	776-777	2	36
β-strand	782-785	4	35
β-strand	789	1	39
β-strand	794	1	39
β-strand	798-804	7	40
β-strand	816-819	4	40
α-helix	821-824	4
β-strand	830-841	12	38
β-strand	842-843	2	41
β-strand	846-847	2	41
β-strand	849	1	42
β-strand	865	1	43
β-strand	870	1	44
β-strand	871	1	43
α-helix	872	1
β-strand	876	1	38
β-strand	882-884	3	44
β-strand	887-889	3	42
α-helix	899-905	7
β-strand	913-915	3	42
β-strand	918-919	2	44
α-helix	920-921	2
β-strand	926-935	10	38
α-helix	943-978	36
α-helix	994-997	4
α-helix	1006-1036	31
α-helix	1039-1040	2
α-helix	1042-1043	2
β-strand	1046-1058	13	38
β-strand	1065-1067	3	45
β-strand	1073-1075	3	45
β-strand	1076-1080	5	40
α-helix	1082-1084	3
β-strand	1087-1088	2	46
α-helix	1092	1
β-strand	1093	1	46
α-helix	1094	1
β-strand	1096-1098	3	40
α-helix	1100-1102	3
β-strand	1108	1	33
α-helix	1110-1133	24
α-helix	1138-1150	13
α-helix	1168-1175	8
β-strand	1182-1183	2	15
α-helix	1192-1201	10
β-strand	1209-1210	2	47
β-strand	1212-1213	2	46
α-helix	1219	1
β-strand	1220	1	46
α-helix	1221	1
β-strand	1225-1226	2	47
β-strand	1227-1232	6	40
β-strand	1233-1234	2	45
β-strand	1235	1	34
α-helix	1239-1242	4
β-strand	1244-1246	3	48
β-strand	1251	1	49
β-strand	1258	1	49
β-strand	1268-1270	3	50
α-helix	1272-1280	9
α-helix	1284-1288	5
α-helix	1289-1293	5
α-helix	1298-1309	12
α-helix	1321-1331	11
β-strand	1336-1339	4	51

Chain J: 56 helices, 85 β-strands

Element	Residues	Length	Sheet
β-strand	20-23	4	51
α-helix	27-33	7
β-strand	34-37	4	52
β-strand	44	1	53
β-strand	51	1	53
β-strand	53	1	54
β-strand	58	1	54
β-strand	66	1	55
β-strand	69	1	55
α-helix	78-80	3
β-strand	84	1	56
β-strand	91	1	56
α-helix	95-99	5
β-strand	102-105	4	52
β-strand	112	1	57
α-helix	114-116	3
α-helix	123-128	6
α-helix	132-139	8
β-strand	144-146	3	58
β-strand	159-160	2	58
α-helix	162-171	10
β-strand	178-179	2	58
α-helix	181-191	11
α-helix	194-206	13
α-helix	211-229	19
α-helix	234-236	3
β-strand	238	1	57
β-strand	242-244	3	52
α-helix	245-246	2
α-helix	247-249	3
β-strand	252-253	2	59
β-strand	261-262	2	59
α-helix	264-283	20
α-helix	289-308	20
α-helix	323-325	3
α-helix	327-331	5
β-strand	345-347	3	50
β-strand	350-354	5	48
β-strand	355-356	2	60
β-strand	365-369	5	60
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	408-416	9
β-strand	421-424	4	48
α-helix	431-433	3
β-strand	434-437	4	48
β-strand	438-442	5	60
β-strand	447-448	2	60
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	48
α-helix	474-477	4
α-helix	479-482	4
β-strand	485	1	48
β-strand	491-492	2	61
β-strand	495-498	4	61
α-helix	505-513	9
β-strand	517	1	62
β-strand	526-527	2	63
α-helix	530-539	10
β-strand	546	1	62
β-strand	547-556	10	63
β-strand	564-573	10	63
α-helix	574-580	7
α-helix	599-612	14
α-helix	615-635	21
α-helix	650-669	20
α-helix	675-702	28
β-strand	706-707	2	64
β-strand	714-715	2	64
α-helix	721-728	8
α-helix	734-741	8
β-strand	745	1	65
β-strand	748	1	66
β-strand	754	1	66
β-strand	759	1	65
α-helix	769-788	20
α-helix	795-803	9
β-strand	809-811	3	67
β-strand	820-822	3	68
α-helix	835-838	4
β-strand	843	1	69
β-strand	844	1	68
β-strand	848	1	70
β-strand	858	1	70
β-strand	863	1	69
α-helix	866-874	9
β-strand	880-882	3	68
α-helix	885-887	3
β-strand	894-895	2	67
α-helix	909-910	2
α-helix	915-924	10
α-helix	926-929	4
β-strand	949	1	71
β-strand	956	1	72
β-strand	957-961	5	73
β-strand	965-967	3	71
β-strand	973-975	3	71
β-strand	981-985	5	73
β-strand	993-996	4	73
β-strand	1002-1003	2	71
β-strand	1011	1	72
β-strand	1019	1	71
β-strand	1021	1	74
β-strand	1024	1	74
β-strand	1026	1	75
β-strand	1033-1038	6	76
β-strand	1046-1051	6	77
β-strand	1056-1061	6	77
β-strand	1077-1081	5	76
α-helix	1088	1
β-strand	1089-1090	2	78
β-strand	1093-1096	4	78
β-strand	1098-1100	3	76
β-strand	1106-1107	2	75
β-strand	1113-1115	3	76
β-strand	1122-1123	2	75
α-helix	1139-1146	8
β-strand	1156	1	79
β-strand	1161	1	80
β-strand	1162-1165	4	81
β-strand	1175-1178	4	81
β-strand	1186-1188	3	81
β-strand	1204	1	80
β-strand	1209	1	79
α-helix	1214-1216	3
α-helix	1217-1223	7
α-helix	1226-1243	18
α-helix	1250-1260	11
β-strand	1263-1266	4	82
β-strand	1279-1281	3	82
α-helix	1282-1294	13
β-strand	1302-1304	3	82
α-helix	1309-1312	4
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1342	2	51
α-helix	1347-1350	4
α-helix	1356-1357	2
α-helix	1363-1372	10

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	16-31	16
α-helix	46-55	10
α-helix	61-74	14

Chain L: 29 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
β-strand	22-23	2	83
α-helix	24-30	7
α-helix	38-51	14
α-helix	54	1
β-strand	55-56	2	83
α-helix	76-87	12
α-helix	97-106	10
α-helix	116-135	20
α-helix	138-152	15
α-helix	215-233	19
α-helix	244-256	13
α-helix	263-291	29
α-helix	299-306	8
α-helix	320-322	3
α-helix	334-351	18
α-helix	355-391	37
α-helix	392-394	3
α-helix	401-416	16
α-helix	427-446	20
α-helix	454-474	21
α-helix	480-486	7
α-helix	493-500	8
α-helix	502-504	3
β-strand	505-506	2	59
β-strand	510	1	84
β-strand	518	1	84
α-helix	519-521	3
α-helix	528-530	3
α-helix	535-549	15
α-helix	553-562	10
α-helix	573-580	8
α-helix	584-599	16
α-helix	605-608	4

Chain M: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	251-254	4
β-strand	256	1	85
α-helix	264-272	9
β-strand	277	1	85
α-helix	278-281	4
α-helix	286-290	5
α-helix	297-309	13
α-helix	316-318	3

Chain N: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-26	23
α-helix	42-45	4
α-helix	46-51	6
α-helix	59-70	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1430	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
Protein TraR	N	protein	72	Escherichia coli	P41065
DNA (85-mer)	O	DNA	85	Escherichia coli
DNA (85-mer)	P	DNA	85	Escherichia coli

Sequence of entity 1 (G, H, M), FASTA

>6PSR_1 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>6PSR_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>6PSR_3 DNA-directed RNA polymerase subunit beta' (chains J)
VKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQGPSSGHHHHHHHHHH

Sequence of entity 4 (K), FASTA

>6PSR_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>6PSR_5 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 6 (N), FASTA

>6PSR_6 Protein TraR (chains N)
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVEC
QAYQERQRKHYA

Sequence of entity 7 (O), FASTA

>6PSR_7 DNA (85-MER) (chains O)
GGCGGCGCTTATTTGCACAAATCCATTGACAAAAGAAGGCTAAAAGGGCATATTCCTCGG
CCTTTGAATTGTCCATATAGAACGC

Sequence of entity 8 (P), FASTA

>6PSR_8 DNA (85-MER) (chains P)
GCGTTCTATATGGACAATTCAAAGGCCGAGGAATATGCCCTTTTAGCCTTCTTTTGTCAA
TGGATTTGTGCAAATAAGCGCCGCC

Ligands and cofactors

ID	Name	Formula	Copies
1N7	Chapso	C32 H59 N2 O8 S	4
ZN	Zinc ion	Zn	3
MG	Magnesium ion	Mg	1

Primary citation

Stepwise Promoter Melting by Bacterial RNA Polymerase. Chen, J., Chiu, C., Gopalkrishnan, S. et al. Mol Cell (2020) 78:275. DOI 10.1016/j.molcel.2020.02.017 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 6PSR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.