6PSS: DNA-directed RNA polymerase subunit alpha

Escherichia coli RNA polymerase promoter unwinding intermediate (TRPi1.5a) with TraR and mutant rpsT P2 promoter. Determined by electron microscopy at 3.5 Å resolution. Released 25 Mar 2020.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,361
Mol. weight: 560.39 kDa
Ligands: MG, ZN
Released: 25 Mar 2020

Explore 6PSS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSS contains 187 α-helices and 239 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
β-strand	23-28	6	1
α-helix	36-49	14
β-strand	52-53	2	2
β-strand	56-61	6	3
β-strand	74	1	4
α-helix	78-86	9
β-strand	90-92	3	5
β-strand	97-100	4	3
β-strand	101-102	2	6
β-strand	103-105	3	7
β-strand	108-110	3	4
β-strand	115-116	2	6
β-strand	121-123	3	5
β-strand	131-133	3	4
β-strand	139-141	3	7
β-strand	142-147	6	3
β-strand	149-150	2	2
β-strand	153	1	8
α-helix	155-158	4
β-strand	170-172	3	3
β-strand	175	1	8
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-231	19

Chain H: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	14-20	7	9
β-strand	23-28	6	9
α-helix	35-49	15
β-strand	53-60	8	10
α-helix	77	1
α-helix	81-86	6
β-strand	90-91	2	11
β-strand	97-105	9	10
α-helix	109	1
β-strand	110	1	12
β-strand	115	1	10
β-strand	122-123	2	11
β-strand	131	1	12
β-strand	139-149	11	10
β-strand	152-153	2	13
β-strand	172	1	10
α-helix	173-174	2
β-strand	175-176	2	13
β-strand	180-184	5	9
β-strand	187-188	2	9
β-strand	200-201	2	9
β-strand	204-207	4	9
α-helix	213-227	15

Chain I: 69 helices, 101 β-strands

Element	Residues	Length	Sheet
β-strand	13-14	2	14
α-helix	19-20	2
α-helix	23-24	2
α-helix	29-36	8
α-helix	49-56	8
β-strand	59-60	2	15
α-helix	62-64	3
β-strand	66-75	10	15
α-helix	76-78	3
α-helix	82-88	7
β-strand	93-106	14	15
β-strand	109-128	20	15
α-helix	129	1
β-strand	130	1	16
β-strand	136-137	2	16
β-strand	142-145	4	16
α-helix	146	1
β-strand	147-151	5	17
α-helix	152	1
β-strand	154-158	5	18
β-strand	173-177	5	18
β-strand	180	1	19
β-strand	184-188	5	18
β-strand	194-197	4	18
β-strand	204-205	2	18
α-helix	208-212	5
α-helix	217-224	8
β-strand	227-231	5	20
β-strand	238-240	3	20
α-helix	273-279	7
β-strand	284-286	3	20
α-helix	289-292	4
β-strand	296	1	21
β-strand	297	1	20
β-strand	301-303	3	22
β-strand	308-311	4	22
β-strand	316	1	21
α-helix	319-326	8
β-strand	333-336	4	20
α-helix	347-351	5
α-helix	359-370	12
α-helix	380-389	10
β-strand	396	1	19
α-helix	399-408	10
α-helix	422-436	15
α-helix	441-443	3
β-strand	451-454	4	17
α-helix	456-465	10
α-helix	467-470	4
α-helix	472-478	7
α-helix	496-505	10
β-strand	512-514	3	16
α-helix	520-527	8
β-strand	529-531	3	17
α-helix	552-554	3
β-strand	558	1	23
β-strand	569	1	17
β-strand	572-574	3	17
β-strand	575	1	23
β-strand	576	1	24
β-strand	580-581	2	25
β-strand	587-594	8	25
β-strand	598	1	26
β-strand	599-607	9	25
α-helix	608-611	4
β-strand	616-617	2	25
β-strand	623	1	27
β-strand	628	1	26
β-strand	629	1	27
β-strand	633-635	3	28
β-strand	636-637	2	25
β-strand	644-646	3	28
β-strand	652-654	3	25
α-helix	657-660	4
β-strand	662	1	24
α-helix	665-667	3
α-helix	671-673	3
α-helix	676-685	10
α-helix	686-688	3
β-strand	689	1	29
α-helix	690-691	2
β-strand	700-701	2	14
α-helix	705-711	7
β-strand	716-717	2	30
β-strand	722-727	6	31
β-strand	731-735	5	31
α-helix	738-740	3
β-strand	748-752	5	31
β-strand	757-758	2	32
β-strand	764-765	2	32
β-strand	768-769	2	30
β-strand	776-777	2	31
β-strand	782-785	4	30
β-strand	789-790	2	33
β-strand	793-794	2	33
β-strand	798-804	7	34
β-strand	816-819	4	34
α-helix	820-824	5
β-strand	830	1	35
β-strand	835-841	7	36
β-strand	842	1	37
β-strand	847	1	37
α-helix	848	1
β-strand	849	1	38
α-helix	861-864	4
β-strand	865	1	39
β-strand	870	1	40
β-strand	871	1	39
α-helix	872	1
β-strand	876	1	41
β-strand	882-884	3	40
β-strand	887	1	38
β-strand	888-889	2	42
α-helix	895-896	2
α-helix	902-905	4
α-helix	908-910	3
β-strand	913-914	2	42
β-strand	918-919	2	40
α-helix	920-921	2
β-strand	927	1	41
β-strand	930-935	6	36
α-helix	943-974	32
α-helix	978-980	3
α-helix	994-997	4
α-helix	1006-1037	32
α-helix	1039-1040	2
α-helix	1042-1043	2
β-strand	1046-1053	8	36
β-strand	1058	1	35
β-strand	1062	1	43
β-strand	1064	1	43
β-strand	1065-1067	3	44
β-strand	1073-1075	3	44
β-strand	1076-1080	5	34
α-helix	1082-1084	3
β-strand	1087	1	45
α-helix	1092	1
β-strand	1093	1	45
α-helix	1094	1
β-strand	1096-1098	3	34
α-helix	1102-1105	4
α-helix	1110-1133	24
α-helix	1138-1148	11
α-helix	1161-1163	3
α-helix	1166-1174	9
β-strand	1182-1183	2	14
α-helix	1192-1201	10
β-strand	1209-1210	2	46
α-helix	1212	1
β-strand	1213	1	45
α-helix	1214	1
α-helix	1219	1
β-strand	1220	1	45
α-helix	1221	1
β-strand	1225-1226	2	46
β-strand	1227-1232	6	34
β-strand	1233-1234	2	44
β-strand	1235	1	29
β-strand	1244-1246	3	47
β-strand	1251	1	48
β-strand	1252	1	49
α-helix	1257	1
β-strand	1258	1	48
α-helix	1259	1
β-strand	1268-1270	3	50
α-helix	1272-1279	8
α-helix	1284-1288	5
α-helix	1298-1310	13
α-helix	1321-1330	10
β-strand	1338-1339	2	51

Chain J: 58 helices, 92 β-strands

Element	Residues	Length	Sheet
β-strand	19-21	3	51
α-helix	27-33	7
β-strand	34-37	4	52
β-strand	44	1	53
β-strand	51	1	53
β-strand	52	1	54
β-strand	58	1	54
β-strand	66	1	55
β-strand	69	1	55
β-strand	84	1	56
β-strand	91	1	56
α-helix	95-99	5
β-strand	102-112	11	52
α-helix	123-128	6
α-helix	132-139	8
β-strand	143-146	4	57
β-strand	159-161	3	57
α-helix	162-169	8
β-strand	178-179	2	57
α-helix	182-191	10
α-helix	194-205	12
α-helix	212-230	19
α-helix	234-236	3
β-strand	238-244	7	52
α-helix	245-246	2
α-helix	247-249	3
β-strand	252-254	3	58
α-helix	256-258	3
β-strand	260-262	3	58
α-helix	264-284	21
α-helix	289-307	19
β-strand	317	1	59
β-strand	323	1	59
α-helix	324-325	2
α-helix	327-331	5
α-helix	337-341	5
β-strand	345-347	3	50
β-strand	350-354	5	47
β-strand	355-356	2	60
β-strand	365-369	5	60
α-helix	370-376	7
α-helix	378-387	10
α-helix	394-403	10
α-helix	408-415	8
β-strand	421-424	4	47
α-helix	431-433	3
β-strand	434-437	4	47
β-strand	438-442	5	60
β-strand	447-449	3	60
α-helix	454-457	4
β-strand	465-469	5	47
α-helix	474-479	6
α-helix	480-484	5
β-strand	485	1	47
β-strand	491	1	61
β-strand	498	1	61
α-helix	505-513	9
β-strand	517	1	62
β-strand	526-527	2	63
α-helix	530-538	9
β-strand	546	1	62
β-strand	547-556	10	63
β-strand	564-573	10	63
α-helix	574-580	7
α-helix	589-591	3
α-helix	598-612	15
α-helix	614-633	20
α-helix	641-643	3
α-helix	650-669	20
α-helix	675-701	27
β-strand	703-706	4	64
β-strand	714-717	4	64
α-helix	721-727	7
α-helix	734-740	7
β-strand	745-748	4	65
β-strand	754-759	6	65
α-helix	769-789	21
α-helix	790-792	3
α-helix	795-803	9
β-strand	809-811	3	66
β-strand	821-822	2	67
β-strand	826	1	68
β-strand	828	1	69
β-strand	831	1	68
α-helix	835-838	4
β-strand	843-844	2	70
α-helix	847	1
β-strand	848-849	2	71
α-helix	850	1
β-strand	856-858	3	71
β-strand	863	1	70
α-helix	866-874	9
β-strand	880-881	2	67
β-strand	882-883	2	70
α-helix	885-887	3
β-strand	894-895	2	66
α-helix	896-899	4
β-strand	901	1	72
β-strand	908	1	72
α-helix	909-910	2
α-helix	915-927	13
β-strand	935-936	2	73
β-strand	949	1	74
β-strand	956	1	75
β-strand	957-960	4	69
β-strand	965-967	3	74
β-strand	973-975	3	74
β-strand	982-985	4	69
β-strand	991-995	5	69
β-strand	1002-1003	2	74
β-strand	1011	1	75
β-strand	1018-1019	2	74
β-strand	1033-1036	4	76
β-strand	1042	1	77
β-strand	1046	1	77
β-strand	1050-1051	2	78
β-strand	1056-1057	2	78
β-strand	1061	1	77
β-strand	1079-1081	3	76
β-strand	1087	1	76
α-helix	1088-1089	2
β-strand	1090	1	79
β-strand	1093	1	79
β-strand	1106-1107	2	80
β-strand	1114-1115	2	76
β-strand	1122-1123	2	80
β-strand	1135-1136	2	73
α-helix	1138-1145	8
β-strand	1156-1157	2	81
β-strand	1161	1	82
β-strand	1162-1165	4	83
β-strand	1172-1173	2	84
β-strand	1175-1178	4	83
β-strand	1187	1	83
β-strand	1190-1191	2	84
β-strand	1204	1	82
β-strand	1208-1209	2	81
α-helix	1217-1223	7
α-helix	1226-1236	11
α-helix	1238-1244	7
α-helix	1252-1260	9
β-strand	1263-1268	6	85
β-strand	1279-1281	3	85
α-helix	1282-1291	10
β-strand	1301-1305	5	85
α-helix	1322-1325	4
α-helix	1328-1337	10
β-strand	1341-1343	3	51
α-helix	1347-1353	7
α-helix	1363-1371	9

Chain K: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	7-13	7
α-helix	16-28	13
α-helix	29-33	5
α-helix	40-41	2
α-helix	46-55	10
α-helix	61-73	13

Chain L: 35 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
β-strand	22	1	86
α-helix	24-30	7
α-helix	38-49	12
β-strand	55	1	86
α-helix	63-65	3
α-helix	75-84	10
α-helix	97-106	10
α-helix	113-135	23
α-helix	138-150	13
α-helix	158-161	4
α-helix	214-232	19
α-helix	245-254	10
α-helix	263-288	26
α-helix	299-301	3
α-helix	302-306	5
α-helix	325-328	4
α-helix	329-332	4
α-helix	337-348	12
α-helix	355-382	28
α-helix	384-391	8
α-helix	401-417	17
α-helix	427-445	19
α-helix	451-453	3
α-helix	454-467	14
α-helix	469-471	3
α-helix	480-486	7
α-helix	495-499	5
β-strand	506	1	58
β-strand	510	1	87
β-strand	518	1	87
α-helix	519-521	3
α-helix	523	1
β-strand	524	1	49
α-helix	525	1
α-helix	531-547	17
α-helix	548-550	3
α-helix	553-561	9
α-helix	573-579	7
α-helix	585-597	13
α-helix	607-610	4

Chain M: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	257-259	3
α-helix	264-272	9
α-helix	278-281	4
α-helix	286-290	5
α-helix	297-307	11

Chain N: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-24	18
α-helix	25-27	3
β-strand	36	1	88
β-strand	43	1	88
α-helix	46-51	6
α-helix	59-69	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1430	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
Protein TraR	N	protein	72	Escherichia coli	P41065
DNA (85-mer)	O	DNA	85	Escherichia coli
DNA (85-mer)	P	DNA	85	Escherichia coli

Sequence of entity 1 (G, H, M), FASTA

>6PSS_1 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>6PSS_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>6PSS_3 DNA-directed RNA polymerase subunit beta' (chains J)
VKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQGPSSGHHHHHHHHHH

Sequence of entity 4 (K), FASTA

>6PSS_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>6PSS_5 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 6 (N), FASTA

>6PSS_6 Protein TraR (chains N)
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVEC
QAYQERQRKHYA

Sequence of entity 7 (O), FASTA

>6PSS_7 DNA (85-MER) (chains O)
GGCGGCGCTTATTTGCACAAATCCATTGACAAAAGAAGGCTAAAAGGGCATATACCTCGG
CCTTTGAATTGTCCATATAGAACGC

Sequence of entity 8 (P), FASTA

>6PSS_8 DNA (85-MER) (chains P)
GCGTTCTATATGGACAATTCAAAGGCCGAGGAATGCGCCCTTTTAGCCTTCTTTTGTCAA
TGGATTTGTGCAAATAAGCGCCGCC

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	1
ZN	Zinc ion	Zn	3

Primary citation

Stepwise Promoter Melting by Bacterial RNA Polymerase. Chen, J., Chiu, C., Gopalkrishnan, S. et al. Mol Cell (2020) 78:275. DOI 10.1016/j.molcel.2020.02.017 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 6PSS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.