6PSW: DNA-directed RNA polymerase subunit alpha

Escherichia coli RNA polymerase promoter unwinding intermediate (TRPo) with TraR and rpsT P2 promoter. Determined by electron microscopy at 3.7 Å resolution. Released 25 Mar 2020.

Method: Electron microscopy
Resolution: 3.7 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,695
Mol. weight: 561.64 kDa
Ligands: 1N7, ZN, MG
Released: 25 Mar 2020

Explore 6PSW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PSW contains 171 α-helices and 218 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	13	1	1
β-strand	17	1	1
β-strand	24-31	8	1
α-helix	35-49	15
β-strand	52-53	2	2
β-strand	56	1	3
β-strand	58-59	2	4
β-strand	61	1	3
β-strand	72	1	5
β-strand	74	1	5
α-helix	78-85	8
β-strand	90-91	2	6
β-strand	97-105	9	3
β-strand	108-111	4	5
α-helix	112-114	3
β-strand	115	1	3
β-strand	122-123	2	6
β-strand	129-133	5	5
β-strand	139-147	9	3
β-strand	149-150	2	2
β-strand	153	1	7
α-helix	156-159	4
α-helix	162-164	3
β-strand	171-172	2	4
β-strand	175	1	7
β-strand	180-189	10	1
α-helix	198	1
β-strand	199-207	9	1
α-helix	213-233	21

Chain H: 6 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	8-11	4
β-strand	16-17	2	8
β-strand	23-31	9	8
α-helix	35-49	15
β-strand	50-60	11	9
β-strand	74	1	10
α-helix	78-87	10
β-strand	89	1	9
β-strand	90-91	2	11
β-strand	99-101	3	9
β-strand	104-105	2	12
β-strand	110-111	2	13
α-helix	112-114	3
α-helix	116-117	2
β-strand	122-123	2	11
β-strand	129-131	3	13
β-strand	133	1	10
β-strand	139-140	2	12
β-strand	143-151	9	9
β-strand	152-153	2	14
β-strand	172	1	9
β-strand	175-176	2	14
β-strand	180-190	11	8
β-strand	198-207	10	8
α-helix	213-226	14

Chain I: 56 helices, 98 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	13-14	2	15
α-helix	19-20	2
α-helix	29-39	11
α-helix	48-56	9
β-strand	58-60	3	16
β-strand	67-75	9	16
α-helix	82-84	3
α-helix	85-89	5
β-strand	93-105	13	16
α-helix	106	1
β-strand	114-128	15	16
β-strand	136-137	2	17
β-strand	142-145	4	17
α-helix	146	1
β-strand	147-148	2	18
β-strand	149-151	3	19
α-helix	152	1
β-strand	154-157	4	20
β-strand	160	1	21
α-helix	166-168	3
β-strand	171	1	21
β-strand	173-177	5	20
β-strand	180	1	22
β-strand	184	1	23
β-strand	185-188	4	20
β-strand	194-196	3	20
β-strand	198	1	23
β-strand	204-205	2	20
α-helix	207-212	6
α-helix	217-224	8
β-strand	228-231	4	24
β-strand	238-240	3	24
α-helix	243-246	4
β-strand	255-257	3	25
β-strand	260-263	4	25
α-helix	267-269	3
α-helix	271-279	9
β-strand	284-286	3	24
α-helix	295	1
β-strand	296-297	2	24
β-strand	301-303	3	26
β-strand	308-311	4	26
β-strand	315-316	2	24
α-helix	319-328	10
β-strand	332-335	4	24
β-strand	339	1	27
β-strand	343	1	27
α-helix	347-353	7
α-helix	359-370	12
α-helix	375-376	2
α-helix	378-388	11
β-strand	396	1	22
α-helix	399-408	10
α-helix	422-436	15
β-strand	451-453	3	19
α-helix	456-478	23
α-helix	495-507	13
β-strand	512-514	3	17
α-helix	520-527	8
β-strand	529	1	28
β-strand	530-531	2	18
α-helix	541-543	3
β-strand	558	1	29
β-strand	574	1	28
β-strand	575	1	29
β-strand	576	1	30
β-strand	580-581	2	31
β-strand	587-588	2	31
β-strand	589-594	6	32
β-strand	599-606	8	32
α-helix	609-612	4
β-strand	616	1	32
β-strand	623	1	33
β-strand	629	1	33
β-strand	633-636	4	34
β-strand	637	1	32
β-strand	643-646	4	34
α-helix	647-649	3
β-strand	652-654	3	32
β-strand	662	1	30
α-helix	665-667	3
α-helix	671-673	3
β-strand	674	1	35
α-helix	676-687	12
α-helix	705-711	7
β-strand	716-717	2	36
β-strand	722-726	5	37
β-strand	731-736	6	37
β-strand	749-752	4	37
β-strand	757-758	2	38
β-strand	764-765	2	38
β-strand	768-769	2	36
β-strand	776-777	2	37
β-strand	782-785	4	36
β-strand	789-790	2	39
β-strand	793-794	2	39
β-strand	798-804	7	40
β-strand	816-819	4	40
α-helix	821-824	4
β-strand	834-840	7	41
β-strand	842-843	2	42
β-strand	846-847	2	42
β-strand	849	1	43
β-strand	865	1	44
β-strand	871	1	44
α-helix	872	1
β-strand	882-884	3	45
β-strand	887-889	3	43
α-helix	895-896	2
α-helix	899-906	8
β-strand	913-915	3	43
β-strand	918-919	2	45
α-helix	920-921	2
β-strand	927-933	7	41
β-strand	936	1	46
α-helix	940-941	2
α-helix	943-971	29
α-helix	972-976	5
α-helix	977-978	2
α-helix	1006-1037	32
β-strand	1040	1	46
β-strand	1048-1055	8	41
β-strand	1065	1	47
β-strand	1067	1	48
β-strand	1075	1	47
β-strand	1076-1080	5	40
β-strand	1087	1	49
β-strand	1093	1	49
β-strand	1096-1098	3	40
α-helix	1102-1105	4
β-strand	1108	1	35
α-helix	1110-1133	24
α-helix	1138-1148	11
α-helix	1168-1175	8
β-strand	1182-1183	2	15
α-helix	1192-1201	10
β-strand	1209-1210	2	40
β-strand	1213	1	49
β-strand	1220	1	49
α-helix	1221	1
β-strand	1225-1232	8	40
β-strand	1233	1	48
α-helix	1239-1242	4
β-strand	1244-1246	3	50
β-strand	1252	1	51
α-helix	1266-1268	3
β-strand	1269-1270	2	52
α-helix	1272-1280	9
α-helix	1285-1288	4
α-helix	1289-1293	5
α-helix	1300-1309	10
α-helix	1321-1330	10
β-strand	1336-1339	4	53

Chain J: 62 helices, 75 β-strands

Element	Residues	Length	Sheet
β-strand	19-23	5	53
α-helix	27-33	7
β-strand	37	1	54
β-strand	66	1	55
β-strand	69	1	55
β-strand	84	1	56
α-helix	90	1
β-strand	91	1	56
α-helix	92	1
α-helix	95-99	5
β-strand	104-112	9	54
α-helix	115-118	4
α-helix	123-127	5
α-helix	132-139	8
β-strand	145-146	2	57
β-strand	159	1	57
α-helix	162-171	10
β-strand	178-179	2	57
α-helix	181-191	11
α-helix	194-207	14
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-243	6	54
α-helix	244-246	3
α-helix	247-249	3
β-strand	252-254	3	58
α-helix	255	1
α-helix	256-258	3
β-strand	260-262	3	58
α-helix	264-285	22
α-helix	289-307	19
β-strand	317	1	59
β-strand	323	1	59
α-helix	324	1
α-helix	337	1
α-helix	338-342	5
β-strand	345-346	2	52
β-strand	350-354	5	50
β-strand	355-356	2	60
β-strand	365-369	5	61
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	408-415	8
β-strand	421-425	5	50
α-helix	431-433	3
β-strand	434-437	4	50
β-strand	438-442	5	61
β-strand	447-448	2	60
α-helix	454-457	4
β-strand	465-469	5	50
α-helix	474-479	6
α-helix	480-484	5
β-strand	485	1	50
α-helix	486-488	3
β-strand	491	1	62
β-strand	498	1	62
α-helix	505-514	10
β-strand	517	1	63
β-strand	526-527	2	64
α-helix	530-539	10
β-strand	546	1	63
β-strand	548-556	9	64
β-strand	564-572	9	64
α-helix	574-579	6
α-helix	589-592	4
α-helix	599-612	14
α-helix	615-635	21
α-helix	641-643	3
α-helix	649-669	21
α-helix	675-702	28
α-helix	721-728	8
α-helix	734-740	7
α-helix	746-747	2
β-strand	748	1	65
β-strand	754	1	65
α-helix	769-789	21
α-helix	791-803	13
β-strand	820-822	3	66
β-strand	825-826	2	67
β-strand	831-833	3	67
α-helix	835-838	4
β-strand	844	1	66
β-strand	848-849	2	68
β-strand	856-858	3	68
α-helix	866-875	10
β-strand	880-882	3	66
α-helix	896-899	4
α-helix	908-909	2
α-helix	915-924	10
α-helix	925-929	5
β-strand	949	1	69
β-strand	952	1	70
β-strand	956-957	2	71
β-strand	959-961	3	72
β-strand	965-967	3	69
β-strand	973-975	3	69
β-strand	981-983	3	72
β-strand	994-996	3	72
α-helix	1001	1
β-strand	1002-1003	2	69
β-strand	1010-1011	2	71
β-strand	1015	1	70
β-strand	1018-1019	2	69
β-strand	1024-1026	3	73
β-strand	1033	1	74
β-strand	1034-1038	5	75
β-strand	1042	1	76
β-strand	1046-1051	6	76
β-strand	1056-1061	6	76
β-strand	1077-1081	5	75
β-strand	1087	1	75
β-strand	1097-1100	4	75
β-strand	1106-1107	2	73
β-strand	1115	1	74
β-strand	1122-1125	4	73
α-helix	1138-1146	9
α-helix	1153-1155	3
β-strand	1156-1157	2	77
β-strand	1161-1165	5	78
β-strand	1173-1178	6	78
β-strand	1187-1190	4	78
β-strand	1203-1204	2	78
β-strand	1208-1209	2	77
α-helix	1217-1224	8
α-helix	1226-1244	19
α-helix	1250-1260	11
β-strand	1263-1268	6	79
β-strand	1279-1281	3	79
α-helix	1282-1292	11
β-strand	1301-1304	4	79
α-helix	1309-1313	5
α-helix	1319-1322	4
α-helix	1328-1338	11
β-strand	1341-1343	3	53
α-helix	1347-1352	6
α-helix	1362-1373	12

Chain K: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	8-13	6
α-helix	18-31	14
α-helix	46-55	10
α-helix	63-79	17

Chain L: 27 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	97-105	9
α-helix	115-135	21
α-helix	138-152	15
α-helix	158-160	3
α-helix	216-232	17
α-helix	245-256	12
α-helix	263-288	26
α-helix	289-293	5
α-helix	294-295	2
α-helix	299-306	8
α-helix	317-320	4
α-helix	334-351	18
α-helix	355-392	38
α-helix	401-418	18
α-helix	427-445	19
α-helix	454-474	21
α-helix	483-486	4
α-helix	493-500	8
α-helix	502-504	3
β-strand	505-506	2	58
β-strand	510	1	80
α-helix	512-514	3
β-strand	518	1	80
α-helix	519-522	4
β-strand	524	1	51
α-helix	531-549	19
α-helix	553-562	10
α-helix	570-572	3
α-helix	573-579	7
α-helix	584-598	15
α-helix	605-610	6

Chain M: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	257-259	3
α-helix	264-272	9
α-helix	278-281	4
α-helix	286-290	5
α-helix	297-309	13

Chain N: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	5-26	22
α-helix	46-51	6
α-helix	59-69	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, M	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1430	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	616	Escherichia coli	P00579
Protein TraR	N	protein	72	Escherichia coli	P41065
DNA (85-mer)	O	DNA	85	Escherichia coli
DNA (85-mer)	P	DNA	85	Escherichia coli

Sequence of entity 1 (G, H, M), FASTA

>6PSW_1 DNA-directed RNA polymerase subunit alpha (chains G, H, M)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>6PSW_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>6PSW_3 DNA-directed RNA polymerase subunit beta' (chains J)
VKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNELELEVLFQGPSSGHHHHHHHHHH

Sequence of entity 4 (K), FASTA

>6PSW_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>6PSW_5 RNA polymerase sigma factor RpoD (chains L)
SEFMEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVME
EAPDADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEI
DIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPT
ATHVGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKA
KGRSHATAQEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKM
PKKNFITLFTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQ
VKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVD
KFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGRE
PTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATT
ESLRAATHDVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRK
LRHPSRSEVLRSFLDD

Sequence of entity 6 (N), FASTA

>6PSW_6 Protein TraR (chains N)
SDEADEAYSVTEQLTMTGINRIRQKINAHGIPVYLCEACGNPIPEARRKIFPGVTLCVEC
QAYQERQRKHYA

Sequence of entity 7 (O), FASTA

>6PSW_7 DNA (85-MER) (chains O)
GGCGGCGCTTATTTGCACAAATCCATTGACAAAAGAAGGCTAAAAGGGCATATTCCTCGG
CCTTTGAATTGTCCATATAGAACGC

Sequence of entity 8 (P), FASTA

>6PSW_8 DNA (85-MER) (chains P)
GCGTTCTATATGGACAATTCAAAGGCCGAGGAATATGCCCTTTTAGCCTTCTTTTGTCAA
TGGATTTGTGCAAATAAGCGCCGCC

Ligands and cofactors

ID	Name	Formula	Copies
1N7	Chapso	C32 H59 N2 O8 S	2
ZN	Zinc ion	Zn	3
MG	Magnesium ion	Mg	1

Primary citation

Stepwise Promoter Melting by Bacterial RNA Polymerase. Chen, J., Chiu, C., Gopalkrishnan, S. et al. Mol Cell (2020) 78:275. DOI 10.1016/j.molcel.2020.02.017 · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 6PSW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.