6PY8: RBPJ-NOTCH1-NRARP ternary complex

Crystal structure of the RBPJ-NOTCH1-NRARP ternary complex bound to DNA. Determined by X-ray diffraction at 3.75 Å resolution. Released 14 Aug 2019.

Method: X-ray diffraction
Resolution: 3.75 Å
Organism: Homo sapiens
Chains: 10
Atoms: 13,305
Mol. weight: 226.37 kDa
Released: 14 Aug 2019

Explore 6PY8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6PY8 contains 62 α-helices and 94 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	16-22	7
α-helix	23-25	3
α-helix	28-36	9
α-helix	54-61	8
α-helix	64-72	9
α-helix	87-94	8
α-helix	97-105	9

Chain C: 11 helices, 45 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	19-28	10
β-strand	34-39	6	3
β-strand	41-43	3	4
β-strand	45	1	5
β-strand	58-60	3	3
α-helix	65-74	10
β-strand	85-91	7	6
α-helix	97-98	2
β-strand	99-101	3	6
β-strand	108-110	3	3
β-strand	117	1	5
β-strand	124-125	2	4
β-strand	127-133	7	6
β-strand	138-143	6	6
β-strand	147-150	4	4
β-strand	166	1	7
β-strand	172-177	6	8
β-strand	187-188	2	8
β-strand	190-192	3	9
β-strand	195-197	3	9
β-strand	206-211	6	8
β-strand	223-224	2	8
β-strand	229	1	10
β-strand	233-238	6	8
β-strand	244	1	8
α-helix	245-247	3
β-strand	248-252	5	8
β-strand	253	1	11
β-strand	258-259	2	11
β-strand	265	1	10
β-strand	267	1	7
β-strand	270-276	7	8
β-strand	283-287	5	8
β-strand	290-294	5	8
β-strand	302	1	11
β-strand	305-306	2	11
β-strand	314-318	5	8
β-strand	319-324	6	3
β-strand	327-328	2	12
β-strand	342-349	8	13
α-helix	352-354	3
β-strand	356-362	7	13
β-strand	368-372	5	12
β-strand	376	1	12
β-strand	379-383	5	13
β-strand	386-390	5	13
α-helix	391-393	3
α-helix	394-396	3
β-strand	408-411	4	14
β-strand	412-416	5	12
β-strand	420-422	3	12
α-helix	423	1
β-strand	427-430	4	14
α-helix	431-432	2
α-helix	436-438	3

Chain E: 9 helices, 42 β-strands

Element	Residues	Length	Sheet
α-helix	12-14	3
α-helix	19-28	10
β-strand	34-39	6	15
β-strand	41-43	3	16
β-strand	45	1	17
β-strand	58-60	3	15
α-helix	65-74	10
β-strand	85-91	7	16
α-helix	98	1
β-strand	99-101	3	16
β-strand	108-110	3	15
β-strand	117	1	17
β-strand	124-133	10	16
β-strand	138-150	13	16
β-strand	168	1	18
β-strand	171-176	6	19
β-strand	190-192	3	19
β-strand	195-197	3	19
β-strand	206-211	6	19
β-strand	223-224	2	19
β-strand	227	1	18
β-strand	229	1	20
β-strand	233-238	6	19
β-strand	243	1	21
β-strand	244	1	19
β-strand	248-252	5	19
β-strand	253	1	22
β-strand	258-259	2	22
β-strand	265	1	20
β-strand	270-275	6	19
β-strand	283-287	5	19
β-strand	290-294	5	19
β-strand	305-306	2	22
β-strand	314-318	5	19
β-strand	319-324	6	15
β-strand	327-328	2	23
β-strand	342-349	8	24
α-helix	352-354	3
β-strand	356-362	7	24
β-strand	368-372	5	23
β-strand	375-376	2	23
β-strand	379-383	5	24
β-strand	386-390	5	24
α-helix	391-393	3
α-helix	394-396	3
β-strand	408-411	4	25
β-strand	412-416	5	23
β-strand	420-422	3	23
α-helix	423	1
β-strand	427-430	4	25
α-helix	431-432	2

Chain F: 15 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1766	1	21
α-helix	1774-1776	3
α-helix	1885-1891	7
α-helix	1907-1915	9
α-helix	1932-1938	7
α-helix	1942-1950	9
α-helix	1965-1971	7
α-helix	1975-1982	8
α-helix	1999-2005	7
α-helix	2013-2017	5
α-helix	2032-2038	7
α-helix	2042-2050	9
α-helix	2065-2071	7
α-helix	2075-2083	9
α-helix	2098-2104	7
α-helix	2108-2116	9

Chain G: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	32-35	4
β-strand	47	1	1
β-strand	53	1	1
α-helix	54-61	8
α-helix	64-72	9
β-strand	80	1	2
β-strand	86	1	2
α-helix	87-94	8
α-helix	97-107	11

Chain K: 15 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1774-1776	3
α-helix	1885-1892	8
α-helix	1907-1916	10
α-helix	1932-1938	7
α-helix	1942-1950	9
α-helix	1965-1971	7
α-helix	1975-1982	8
α-helix	1999-2005	7
α-helix	2013-2017	5
β-strand	2025	1	26
β-strand	2031	1	26
α-helix	2032-2038	7
α-helix	2042-2050	9
α-helix	2065-2071	7
α-helix	2075-2083	9
α-helix	2098-2104	7
α-helix	2108-2116	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Notch-regulated ankyrin repeat-containing protein	B, G	protein	114	Homo sapiens	Q7Z6K4 (AlphaFold model)
DNA	A, X	DNA	16	Homo sapiens
DNA	D, Y	DNA	16	Homo sapiens
Recombining binding protein suppressor of hairless	C, E	protein	444	Homo sapiens	Q06330 (AlphaFold model)
Neurogenic locus notch homolog protein 1	F, K	protein	369	Homo sapiens	P46531 (AlphaFold model)

Sequence of entity 1 (B, G), FASTA

>6PY8_1 Notch-regulated ankyrin repeat-containing protein (chains B, G)
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVI
DGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

Sequence of entity 2 (A, X), FASTA

>6PY8_2 DNA (chains A, X)
TTGACTGTGGGAAAGA

Sequence of entity 3 (D, Y), FASTA

>6PY8_3 DNA (chains D, Y)
AATCTTTCCCACAGTC

Sequence of entity 4 (C, E), FASTA

>6PY8_4 Recombining binding protein suppressor of hairless (chains C, E)
GERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKK
KKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLS
VKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLRSQTVSTRY
LHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRL
IIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEPNKEMI
NDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNL
RVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTF
TYTPEPGPRPHCSAAGAILRANSS

Sequence of entity 5 (F, K), FASTA

>6PY8_5 Neurogenic locus notch homolog protein 1 (chains F, K)
KRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNASDGALMDDNQNEWGDEDL
ETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAPTPPQGEVDADCMDVNVRG
PDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASLHNQTDRTGETALHLAARY
SRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTP
LILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQN
NREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNL
VRSPQLHGA

Primary citation

Extension of the Notch intracellular domain ankyrin repeat stack by NRARP promotes feedback inhibition of Notch signaling. Jarrett, S.M., Seegar, T.C.M., Andrews, M. et al. Sci Signal (2019) 12. DOI 10.1126/scisignal.aay2369 · PubMed

Browse structure collections

About this viewer

MolViewer shows 6PY8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.