Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with the NVP-BHG712 derivative ATDL11. Determined by X-ray diffraction at 1.05 Å resolution. Released 15 Jan 2020.
Explore 6Q7C in 3D Show helices and sheets RCSB PDB PDBe
6Q7C contains 22 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 600-602 | 3 | |
| α-helix | 605-606 | 2 | |
| β-strand | 607 | 1 | 1 |
| α-helix | 608-609 | 2 | |
| α-helix | 610-612 | 3 | |
| β-strand | 613-620 | 8 | 1 |
| β-strand | 627-632 | 6 | 1 |
| α-helix | 640 | 1 | |
| β-strand | 641-648 | 8 | 1 |
| α-helix | 654-669 | 16 | |
| β-strand | 675 | 1 | 2 |
| α-helix | 676-677 | 2 | |
| β-strand | 678-682 | 5 | 1 |
| β-strand | 688-693 | 6 | 1 |
| β-strand | 699 | 1 | 2 |
| α-helix | 700-706 | 7 | |
| α-helix | 713-732 | 20 | |
| α-helix | 742-744 | 3 | |
| β-strand | 745-747 | 3 | 2 |
| β-strand | 753-755 | 3 | 2 |
| α-helix | 781-783 | 3 | |
| α-helix | 786-791 | 6 | |
| α-helix | 796-811 | 16 | |
| α-helix | 815-816 | 2 | |
| α-helix | 823-831 | 9 | |
| α-helix | 836-839 | 4 | |
| β-strand | 843 | 1 | 3 |
| α-helix | 844-853 | 10 | |
| α-helix | 858-860 | 3 | |
| α-helix | 862-863 | 2 | |
| α-helix | 864-876 | 13 | |
| α-helix | 878-881 | 4 | |
| β-strand | 884 | 1 | 3 |
| α-helix | 885-887 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ephrin type-A receptor 2 | A | protein | 306 | Homo sapiens | P29317 (AlphaFold model) |
>6Q7C_1 Ephrin type-A receptor 2 (chains A) GDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTE KQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVL QLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTT SGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGF RLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIR LPSTSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| HOK | 3-[[4-imidazol-1-yl-6-[(3~{S})-3-oxidanylpiperidin-1-yl]-1,3,5-triazin-2-yl]ami… | C26 H25 F3 N8 O2 | 1 |
Effects of NVP-BHG712 chemical modifications on EPHA2 binding and affinity. Troester, A., Kudlinzki, D., Saxena, K. et al. To be published.
Other PDB entries of the same protein (UniProt P29317 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6Q7C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.