Fibrinogen-like globe domain of Human Tenascin-C. Determined by X-ray diffraction at 1.4 Å resolution. Released 27 Feb 2019.
Explore 6QNV in 3D Show helices and sheets RCSB PDB PDBe
6QNV contains 11 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1984-1988 | 5 | |
| β-strand | 1996-2001 | 6 | 1 |
| α-helix | 2002-2004 | 3 | |
| β-strand | 2009-2015 | 7 | 1 |
| α-helix | 2018-2020 | 3 | |
| β-strand | 2023-2029 | 7 | 1 |
| α-helix | 2040-2045 | 6 | |
| β-strand | 2047-2048 | 2 | 1 |
| β-strand | 2054-2055 | 2 | 1 |
| α-helix | 2058-2065 | 8 | |
| β-strand | 2070-2078 | 9 | 1 |
| β-strand | 2081-2092 | 12 | 1 |
| α-helix | 2095-2097 | 3 | |
| β-strand | 2101-2108 | 8 | 1 |
| α-helix | 2115-2117 | 3 | |
| α-helix | 2120-2122 | 3 | |
| β-strand | 2123 | 1 | 2 |
| α-helix | 2136-2140 | 5 | |
| β-strand | 2144 | 1 | 2 |
| β-strand | 2152-2153 | 2 | 3 |
| β-strand | 2168-2169 | 2 | 3 |
| α-helix | 2170-2173 | 4 | |
| β-strand | 2181-2188 | 8 | 1 |
| α-helix | 2189-2193 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tenascin | A | protein | 220 | Homo sapiens | P24821 (AlphaFold model) |
>6QNV_1 Tenascin (chains A) SMPFPKDCSQAMLNGDTTSGLYTIYLNGDKAQALEVFCDMTSDGGGWIVFLRRKNGRENF YQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAK TRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMG RYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEG
Fibrinogen-like globe domain of Human Tenascin-C. Coker, J.A., Bezerra, G.A., Bradshaw, W.J. et al. To be published.
Other PDB entries of the same protein (UniProt P24821 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6QNV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.