Crystal structure of an Arabidopsis WD40 domain in complex with a transcription factor homolog. Determined by X-ray diffraction at 1.51 Å resolution. Released 10 Jul 2019.
Explore 6QTT in 3D Show helices and sheets RCSB PDB PDBe
6QTT contains 2 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 355-362 | 8 | 1 |
| β-strand | 374-379 | 6 | 2 |
| β-strand | 385-390 | 6 | 2 |
| β-strand | 394-399 | 6 | 2 |
| α-helix | 400-405 | 6 | |
| β-strand | 415-418 | 4 | 2 |
| β-strand | 423-428 | 6 | 3 |
| β-strand | 435-440 | 6 | 3 |
| β-strand | 445-449 | 5 | 3 |
| β-strand | 455-459 | 5 | 3 |
| β-strand | 466-471 | 6 | 4 |
| β-strand | 478-483 | 6 | 4 |
| β-strand | 487-492 | 6 | 4 |
| β-strand | 500-503 | 4 | 4 |
| β-strand | 508-513 | 6 | 5 |
| β-strand | 520-525 | 6 | 5 |
| β-strand | 530-534 | 5 | 5 |
| β-strand | 543-545 | 3 | 5 |
| β-strand | 552-557 | 6 | 6 |
| β-strand | 562-567 | 6 | 6 |
| β-strand | 571-576 | 6 | 6 |
| β-strand | 581-586 | 6 | 6 |
| β-strand | 594 | 1 | 7 |
| β-strand | 598-600 | 3 | 8 |
| β-strand | 604-607 | 4 | 8 |
| β-strand | 613-618 | 6 | 8 |
| β-strand | 626-629 | 4 | 8 |
| β-strand | 647-652 | 6 | 1 |
| β-strand | 658-663 | 6 | 1 |
| β-strand | 668-674 | 7 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 30 | 1 | 7 |
| α-helix | 31-32 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase COP1 | A | protein | 330 | Arabidopsis thaliana | P43254 (AlphaFold model) |
| Transcription factor HY5-like | B | protein | 10 | Arabidopsis thaliana | Q8W191 (AlphaFold model) |
>6QTT_1 E3 ubiquitin-protein ligase COP1 (chains A) GAMTFTRYSRLRVIAEIRHGDIFHSANIVSSIEFDRDDELFATAGVSRCIKVFDFSSVVN EPADMQCPIVEMSTRSKLSCLSWNKHEKNHIASSDYEGIVTVWDVTTRQSLMEYEEHEKR AWSVDFSRTEPSMLVSGSDDCKVKVWCTRQEASVINIDMKANICCVKYNPGSSNYIAVGS ADHHIHYYDLRNISQPLHVFSGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNLPVRT FRGHTNEKNFVGLTVNSEYLACGSETNEVYVYHKEITRPVTSHRFGSPDMDDAEEEAGSY FISAVCWKSDSPTMLTANSQGTIKVLVLAA
>6QTT_2 Transcription factor HY5-like (chains B) XELLMVPDMY
| ID | Name | Formula | Copies |
|---|---|---|---|
| MLI | Malonate ion | C3 H2 O4 | 2 |
Water and common crystallization additives (GOL) are not listed.
Plant photoreceptors and their signaling components compete for COP1 binding via VP peptide motifs. Lau, K., Podolec, R., Chappuis, R. et al. EMBO J (2019) 38:e102140-e102140. DOI 10.15252/embj.2019102140 · PubMed
Other PDB entries of the same protein (UniProt P43254 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6QTT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.