6QZH: Human CC Chemokine Receptor 7

Structure of the human CC Chemokine Receptor 7 in complex with the intracellular allosteric antagonist Cmp2105 and the insertion protein Sialidase NanA. Determined by X-ray diffraction at 2.1 Å resolution. Released 4 Sept 2019.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Homo sapiens, Streptococcus pneumoniae
Chains: 1
Atoms: 6,116
Mol. weight: 89.29 kDa
Ligands: TAR, JLW
Released: 4 Sept 2019

Explore 6QZH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QZH contains 26 α-helices and 40 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 26 helices, 40 β-strands

Element	Residues	Length	Sheet
α-helix	56-84	29
α-helix	87-89	3
α-helix	92-108	17
α-helix	111-119	9
α-helix	125-157	33
α-helix	168-171	4
α-helix	173-190	18
α-helix	191-195	5
β-strand	197-200	4	1
β-strand	209-212	4	1
α-helix	221-228	8
α-helix	229-233	5
α-helix	234-1003	21
β-strand	1006-1009	4	2
β-strand	1013	1	3
β-strand	1024-1032	9	4
β-strand	1038-1045	8	4
β-strand	1055-1062	8	4
β-strand	1073-1076	4	4
α-helix	1078-1080	3
α-helix	1087-1089	3
β-strand	1093-1101	9	5
β-strand	1108-1115	8	5
α-helix	1120-1123	4
β-strand	1132-1135	4	6
β-strand	1138-1145	8	6
β-strand	1152-1154	3	6
α-helix	1156-1158	3
β-strand	1159-1161	3	6
β-strand	1167-1172	6	6
α-helix	1179-1181	3
β-strand	1186-1189	4	6
β-strand	1192-1196	5	6
β-strand	1207-1209	3	6
β-strand	1214-1220	7	5
α-helix	1228-1230	3
β-strand	1231-1232	2	5
α-helix	1234-1237	4
β-strand	1242-1247	6	7
β-strand	1250-1251	2	5
β-strand	1253-1254	2	7
β-strand	1264-1272	9	7
α-helix	1276-1279	4
β-strand	1282-1288	7	7
β-strand	1296-1297	2	7
β-strand	1305-1306	2	8
β-strand	1311-1312	2	8
α-helix	1320-1322	3
β-strand	1327-1331	5	9
β-strand	1337-1341	5	9
β-strand	1347-1353	7	9
β-strand	1365-1371	7	9
β-strand	1378-1384	7	10
β-strand	1387-1395	9	10
β-strand	1401-1410	10	10
β-strand	1416-1428	13	10
β-strand	1432-1438	7	2
β-strand	1441-1448	8	2
β-strand	1453	1	3
α-helix	1454	1
β-strand	1457-1464	8	2
α-helix	1465-1469	5
α-helix	264-274	11
α-helix	276-285	10
α-helix	300-327	28
α-helix	332-338	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C chemokine receptor type 7,Sialidase A,C-C chemokine receptor type 7	A	protein	785	Homo sapiens, Streptococcus pneumoniae	P32248 (AlphaFold model), P62576 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6QZH_1 C-C chemokine receptor type 7,Sialidase A,C-C chemokine receptor type 7 (chains A)
GPGSSLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLA
VADILFLLTLPFWAYSAAKSWVFGVHFCKLIFAIYKMSFFSGMWLLLCISIDRYVAIVQA
VSAHRHRARVLLISKLSCVGIWILATVLSIPELLYSDLQRSSSEQAMRCSLITEHVEAFI
TIQVAQMVIGFLVPLLAMSFCYLVIISKLHALTEKTDIFESGRNGNPNKDGIKSYRIPAL
LKTDKGTLIAGADERRLHSSDWGDIGMVIRRSEDNGKTWGDRVTITNLRDNPKASDPSIG
SPVNIDMVLVQDPETKRIFSIYDMFPEGKGIFGMSSQKEEAYKKIDGKTYQILYREGEKG
AYTIRENGTVYTPDGKATDYRVVVDPVKPAYSDKGDLYKGDQLLGNIYFTTNKTSPFRIA
KDSYLWMSYSDDDGKTWSAPQDITPMVKADWMKFLGVGPGTGIVLRNGPHKGRILIPVYT
TNNVSHLDGSQSSRVIYSDDHGKTWHAGEAVNDNRQVDGQKIHSSTMNNRRAQNTESTVV
QLNNGDVKLFMRGLTGDLQVATSKDGGVTWEKDIKRYPQVKDVYVQMSAIHTMHEGKEYI
ILSNAGGPKRENGMVHLARVEENGELTWLKHNPIQKGEFAYNSLQELGNGEYGILYEHTE
KGQNAYTLSFRKFNWEFLSKSKGHERNKAIKVIIAVVVVFIVFQLPYNGVVLAQTVANFN
ITSSTCELSKQLNIAYDVTYSLACVRCCVNPFLYAFIGVKFRNDLFKLFKDLGCLSGGRL
EVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
TAR	D(-)-tartaric acid	C4 H6 O6	2
JLW	3-[[4-[[(1~{R})-2,2-dimethyl-1-(5-methylfuran-2-yl)propyl]amino]-1,1-bis(oxidan…	C22 H29 N5 O5 S	1

Water and common crystallization additives (NA, PGE) are not listed.

Primary citation

Structural Basis for Allosteric Ligand Recognition in the Human CC Chemokine Receptor 7. Jaeger, K., Bruenle, S., Weinert, T. et al. Cell (2019) 178:1222-1230.e10. DOI 10.1016/j.cell.2019.07.028 · PubMed

Other PDB entries of the same protein (UniProt P32248 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9KO2 2.98 Å, A Cryo_EM structure of CCR7 complex with CCL19
9XHH 3.0 Å, Structure of the CCL19-CCR7-Gi-scFv16 complex
9XHI 3.2 Å, Structure of the CCL21-CCR7-Gi-scFv16 complex
9KO4 3.3 Å, A Cryo_EM structure of CCR7 complex with CCL21
9KO6 3.3 Å, A local Cryo_EM structure of CCR7 complex with CCL19
9L16 3.5 Å, A local Cryo_EM structure of CCR7 complex with CCL21

Browse structure collections

About this viewer

MolViewer shows 6QZH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.