6RQR: Extended NHERF1 PDZ2 domain

Extended NHERF1 PDZ2 domain in complex with the PDZ-binding motif of CFTR. Determined by X-ray diffraction at 2.2 Å resolution. Released 5 Feb 2020.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,138
Mol. weight: 32.24 kDa
Released: 5 Feb 2020

Explore 6RQR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6RQR contains 12 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	153-158	6	1
β-strand	160	1	2
β-strand	163	1	2
β-strand	166-170	5	1
β-strand	177-182	6	1
α-helix	187-190	4
β-strand	198-202	5	1
β-strand	205-206	2	1
α-helix	212-220	9
β-strand	225-231	7	1
α-helix	233-242	10
α-helix	249-252	4
α-helix	254-260	7
α-helix	261-265	5

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	153-158	6	3
β-strand	160	1	4
β-strand	163	1	4
β-strand	166-171	6	3
β-strand	174-182	9	3
α-helix	187-190	4
β-strand	198-202	5	3
β-strand	205-206	2	3
α-helix	212-220	9
β-strand	225-231	7	3
α-helix	233-242	10
α-helix	249-252	4
α-helix	254-260	7
α-helix	261-265	5
β-strand	269-272	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Cystic fibrosis transmembrane conductance regulator	A, B	protein	144	Homo sapiens	O14745 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6RQR_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF1,Cystic fibrosis transmembrane conductance regulator (chains A, B)
MAEEHHHHHHHHLEVLFQGPLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAE
ASGLRAQDRIVEVNGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQE
HLNGPLPVPFTNGEIQKENSDTRL

Primary citation

In vivocrystals reveal critical features of the interaction between cystic fibrosis transmembrane conductance regulator (CFTR) and the PDZ2 domain of Na+/H+exchange cofactor NHERF1. Martin, E.R., Barbieri, A., Ford, R.C. et al. J Biol Chem (2020) 295:4464-4476. DOI 10.1074/jbc.RA119.012015 · PubMed

Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N6X 1.05 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
4MPA 1.1 Å, Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
4LMM 1.1 Å, Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21…
4JL7 1.16 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
9RXT 1.36 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of…
9RXQ 1.38 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of…
4Q3H 1.44 Å, The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric…
4PQW 1.47 Å, Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1
1G9O 1.5 Å, First PDZ domain of the human na+/h+ exchanger regulatory factor
2OZF 1.5 Å, The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
1I92 1.7 Å, Structural basis of the nherf PDZ1-cftr interaction
1GQ5 2.2 Å, Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR

Browse structure collections

About this viewer

MolViewer shows 6RQR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.