6S0A: Properdin

Crystal Structure of Properdin (TSR domains N12 & 456). Determined by X-ray diffraction at 2.52 Å resolution. Released 4 Sept 2019.

Method: X-ray diffraction
Resolution: 2.52 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,906
Mol. weight: 46.09 kDa
Ligands: MAN, FUC
Released: 4 Sept 2019

Explore 6S0A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6S0A contains 12 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	256	1	1
β-strand	260	1	2
β-strand	264-265	2	3
β-strand	275-281	7	3
β-strand	284	1	2
α-helix	288-289	2
β-strand	290	1	1
α-helix	293-297	5
β-strand	301-307	7	3
α-helix	311-313	3
β-strand	314	1	4
β-strand	317-318	2	5
α-helix	319-321	3
α-helix	323-326	4
β-strand	328	1	6
β-strand	342-347	6	6
β-strand	350-351	2	5
β-strand	354	1	4
α-helix	357-361	5
β-strand	365-372	8	6
β-strand	377-379	3	7
β-strand	380-382	3	8
α-helix	383-388	6
β-strand	392	1	9
β-strand	400-406	7	9
β-strand	407-409	3	8
β-strand	417-418	2	10
β-strand	427-428	2	10
β-strand	429-432	4	6
β-strand	436-438	3	7
β-strand	442	1	11
β-strand	445	1	11
β-strand	448-454	7	9
α-helix	458-460	3

Chain B: 4 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	30-37	8	12
β-strand	42-51	10	12
α-helix	53-56	4
β-strand	63-65	3	12
β-strand	73-74	2	12
β-strand	79-80	2	13
α-helix	85-89	5
β-strand	95-103	9	14
β-strand	104-105	2	13
α-helix	119	1
β-strand	120-128	9	14
α-helix	134-137	4
β-strand	155-156	2	15
β-strand	159-160	2	16
β-strand	179-180	2	16
β-strand	183-184	2	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Properdin	A	protein	225	Homo sapiens	P27918 (AlphaFold model)
Properdin	B	protein	166	Homo sapiens	P27918 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6S0A_1 Properdin (chains A)
GSVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCP
VDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSI
QHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWG
RPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEELAAAHHHHHH

Sequence of entity 2 (B), FASTA

>6S0A_2 Properdin (chains B)
GSDPVLCFTQYEESSGKCKGLLGGGVSVEDCCLNTAFAYQKRSGGLCQPCRSPRWSLWST
WAPCSVTCSEGSQLRYRRCVGWNGQCSGKVAPGTLEWQLQACEDQQCCPEMGGWSGWGPW
EPCSVTCSKGTRTRRRACNHPAPKCGGHCPGQAQESEACDTQQVCP

Ligands and cofactors

ID	Name	Formula	Copies
MAN	alpha-D-mannopyranose	C6 H12 O6	10
FUC	alpha-L-fucopyranose	C6 H12 O5	1

Primary citation

Insights Into Enhanced Complement Activation by Structures of Properdin and Its Complex With the C-Terminal Domain of C3b. van den Bos, R.M., Pearce, N.M., Granneman, J. et al. Front Immunol (2019) 10:2097-2097. DOI 10.3389/fimmu.2019.02097 · PubMed

Other PDB entries of the same protein (UniProt P27918 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q6R 1.9 Å, Structure of complement FP in complex with the TPP-3077 VHH
6S08 2.03 Å, Crystal Structure of Properdin (TSR domains N1 & 456)
6S0B 2.31 Å, Crystal Structure of Properdin in complex with the CTC domain of C3/C3b
9U62 2.7 Å, AP pathways C3 convertase C3bBbP and C3 complex
6RUS 2.8 Å, Structure of a functional properdin monomer
7B26 3.4 Å, CirpA1 in complex with pseudo-monomeric Properdin lacking TSR2-3
6SEJ 3.5 Å, Structure of a functional monomeric properdin lacking TSR3
6RV6 3.51 Å, Structure of properdin lacking TSR3 based on anomalous data
7NOZ 3.9 Å, Structure of the nanobody stablized properdin bound alternative pathway proconvertase…
6RUR 6.0 Å, Structure of the SCIN stabilized C3bBb convertase bound to properdin
6RUV 6.15 Å, Structure of the SCIN stabilized C3bBb convertase bound to Properdin and a the…
1W0R Solution structure of dimeric form of properdin by X-ray solution scattering and…

Browse structure collections

About this viewer

MolViewer shows 6S0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.